KEGG   Arthrobacter sp. FB24: Arth_0745Help
Entry
Arth_0745         CDS       T00421                                 

Definition
(GenBank) carbohydrate ABC transporter membrane protein 1, CUT1 family
  KO
K15771  arabinogalactan oligomer / maltooligosaccharide transport system permease protein
Organism
art  Arthrobacter sp. FB24
Pathway
art02010  ABC transporters
Module
art_M00491  arabinogalactan oligomer/maltooligosaccharide transport system
Brite
KEGG Orthology (KO) [BR:art00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Arth_0745
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:art02000]
    Arth_0745
Transporters [BR:art02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Arabinogalactan oligomer/maltooligosaccharide transport system [MD:M00491]
    Arth_0745
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TM_PBP2_N BPD_transp_1 Wzy_C
Motif
Other DBs
NCBI-ProteinID: ABK02143
UniProt: A0JSX3
Position
803607..805280
Genome map
AA seq 557 aa AA seqDB search
MPKTDLFQDSPPPPSPGAAPTSAVAPSPGGRTSGRRPGLPKRSSRQDSIKGTVAKIVLLG
LVDALAVYVLMMLFLSQSWGALAVSSAVVLAINWIYLRKGGLPAKYLAPGVLFLLVFQVF
VVLFSGYIAFTNYGDGHNSTKDDAIAAIQLTAQKRVPDSPAYKAAVLTKGSDFYLLFTDP
DGKASIGSTGTPLNEVPDAGTDSTGKANSVDGYRTLNFQEIVANQQEILAITVPVSDDPA
DGTLRTADGSSAYEFKPALTYDAAADTFTDTDTGAVFRDNGKGAFADGNGQTLTTGWKID
VGMDNFARAFTDPSLRGPLLGVILWTFTFAVASVALTFALGLFLAITFNREDLRGKKVYR
ILMILPYAFPAFLSGLVWSGILNPQFGWLNQTLLGGATIGWLTDPVLAKISVLVVNLWLG
FPYMFLVCTGALQSLPTELDEAARMDGAGPWRVFRSIKLPLLLVSIAPLLISSFAFNFNN
FNVIYMLTGGGPRFADTDRDIGATDILITLVYKVAFGQGTGRDYGLASALAIIIFIIVAT
VSAISFKQTKALEDVNS
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atgcccaaaacagatctcttccaggattccccgccgcccccctcgccgggagccgcgcca
acatcggcagtggcgccatcaccgggcggccgcacctcgggccgccggccggggttgccg
aaacgcagctcccgccaggattccatcaaggggaccgtggccaagatcgtgctcctgggc
ctcgttgacgcactggccgtctatgtcctgatgatgctcttcctgagccagtcctggggt
gccctcgcggtctcgtccgccgtcgtactggccattaactggatctacctccgcaagggg
ggactgcccgcaaaatacctggcgccgggcgtgctgttcctgctggtgttccaggtcttt
gtggtcctcttcagcggctacatcgccttcaccaactacggcgacgggcacaacagcacc
aaggacgacgcaatcgcggccatccagctcacggcccaaaagcgtgtcccggactcgccg
gcctacaaggcggcggtcctcaccaaaggcagcgacttctacctgctgttcaccgatccc
gacggcaaggcttccatcggcagcaccggtacgcccctgaatgaagtgcccgacgccggc
acggactccaccggcaaggccaactccgttgacggctaccggacgctgaacttccaggaa
atcgtggcaaaccagcaggagatcctggccatcacggtgcctgtctcggacgaccccgct
gacggcaccctgcgcacggcggacggcagcagcgcctacgagttcaagccggcgctgacc
tatgacgcggcggccgacaccttcaccgacaccgataccggcgccgttttccgcgacaac
ggcaagggcgccttcgcggacggcaacggccagaccctcaccacgggctggaagatcgac
gtcggtatggataactttgcccgcgccttcaccgatccgagcctgcgcggtccgctgctc
ggtgtcatcctctggaccttcacttttgccgtcgcgtctgttgcgctgaccttcgcgctt
ggcctgttcctggccatcacgttcaaccgcgaggacctgcgtggcaagaaggtctaccgg
atcctgatgatcctgccctatgccttcccggcgttcctgtccggactggtctggtccggt
atcctcaacccgcaattcggctggctcaaccaaacgctgctgggcggcgcgactatcggc
tggctcacggacccggtcctggccaagatcagcgtcctggtggtcaacctatggctgggc
ttcccgtacatgttcctggtctgcaccggcgccctgcagtcgctgccgacggagctcgac
gaggctgcccggatggacggcgccggcccatggcgtgtcttccggtccatcaagcttccc
cttctgctggtctcgattgccccgctgctcatctcctccttcgccttcaacttcaacaac
ttcaatgtgatctacatgctcaccggcggcggaccgcgcttcgcggacaccgaccgcgac
attggagccacggacatcctgatcacgctggtctacaaggtggcgttcgggcaggggacc
ggccgcgactacggcctggccagcgccctggccatcatcattttcatcatcgtggcaacc
gtttcggccatcagcttcaagcagaccaaagcactcgaggacgtgaactcatga

DBGET integrated database retrieval system