KEGG   Arthrobacter sp. FB24: Arth_0815Help
Entry
Arth_0815         CDS       T00421                                 

Definition
(GenBank) succinyl-CoA synthetase (ADP-forming) beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
art  Arthrobacter sp. FB24
Pathway
art00020  Citrate cycle (TCA cycle)
art00640  Propanoate metabolism
art00660  C5-Branched dibasic acid metabolism
art01100  Metabolic pathways
art01110  Biosynthesis of secondary metabolites
art01120  Microbial metabolism in diverse environments
art01130  Biosynthesis of antibiotics
art01200  Carbon metabolism
Module
art_M00009  Citrate cycle (TCA cycle, Krebs cycle)
art_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:art00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Arth_0815
   00640 Propanoate metabolism
    Arth_0815
   00660 C5-Branched dibasic acid metabolism
    Arth_0815
Enzymes [BR:art01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Arth_0815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A CPSase_L_D2
Motif
Other DBs
NCBI-ProteinID: ABK02213
UniProt: A0JT43
Position
883102..884271
Genome map
AA seq 389 aa AA seqDB search
MDLFEYQARDMFEAHGVPVLAGIVAHTPEEAKAAAEKIGGVTVVKAQVKVGGRGKAGGVK
VAKTADEALEHSTNILGMDIKGHTVNKVMIAQGADIAEEYYFSVLLDRANRNYLAMCSVE
GGMEIEQLAVERPDALAKVAIDPAVGIDQAKADEIVAAAGFAEELRGKVADVILKLWDVF
KKEDATLVEVNPLVKTGAGDIVALDGKVTLDENADFRHAKHALLEDKDAADPLEAKAKAQ
DLNYVKLDGEVGIIGNGAGLVMSTLDVVAYAGENHGNVKPANFLDIGGGASAEVMAAGLD
VILGDEQVKSVFVNVFGGITACDAVAKGIVGALAELGHSANKPLVVRLDGNNVEEGRRIL
AEANHPLVTLAATMDEGADKAAELANAAK
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
gtggacctgtttgaatatcaggcgcgcgatatgttcgaggcgcacggtgtacccgtgctt
gctggcatcgtggcgcacacccctgaagaagcaaaggcagctgccgagaagatcggcggc
gtaactgtcgtcaaggcacaggttaaggtcggtggccgcggcaaggccggcggcgttaag
gtcgcaaagaccgccgacgaggcgctggagcactccaccaacatcctgggcatggacatc
aagggccacacggtcaacaaggtcatgatcgcccagggcgcggacatcgccgaggaatac
tacttctccgttctgctggaccgggccaaccgcaactacctggccatgtgctcggttgaa
ggcggcatggaaatcgaacagctcgccgtcgaacgccccgacgcactggcaaaggtcgcc
atcgatcccgcagtgggaatcgaccaggccaaggccgacgaaatcgttgccgctgccggc
ttcgctgaggaactgcgcggcaaagtcgccgacgtcatcctgaagctctgggacgttttc
aagaaggaagacgccaccctggtggaggtcaacccgctcgtcaagaccggcgccggagac
atcgttgcccttgacggcaaggtgaccctggacgagaacgccgacttccggcacgccaag
cacgcactcctggaagacaaggacgctgctgatccgctcgaggccaaggccaaggcgcag
gacctgaactacgtcaagctggacggcgaagtcggcatcatcggcaacggcgccggtctg
gtcatgtccaccctggacgtcgttgcctacgccggtgaaaaccacggcaacgtcaagccg
gccaacttcctggacatcggcggcggagcctccgccgaggtcatggcagccggcctggac
gtcatcctgggcgacgagcaggtcaagtccgtgttcgtcaacgtcttcggcggaatcacc
gcgtgcgacgccgtggccaagggcatcgtcggagcattggccgagctgggccactccgcg
aacaagccgctggtcgtccgcctcgacggcaacaacgtcgaggaaggccgccgcatcctg
gccgaggccaaccacccgctggttaccctggccgccaccatggacgagggcgccgacaag
gccgccgagctcgccaacgcagctaagtaa

DBGET integrated database retrieval system