KEGG   Arthrobacter sp. FB24: Arth_0880Help
Entry
Arth_0880         CDS       T00421                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
art  Arthrobacter sp. FB24
Pathway
art00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:art00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Arth_0880
Enzymes [BR:art01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     Arth_0880
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     Arth_0880
    1.1.1.-  
     Arth_0880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 FAD_binding_3 AdoHcyase_NAD
Motif
Other DBs
NCBI-ProteinID: ABK02278
UniProt: A0JTA8
Position
951841..952896
Genome map
AA seq 351 aa AA seqDB search
MKAARFHAREDLRIEDIPEPELRPGAVKIAIAWCGICGTDLHEFLEGPIFTPPPGQPHTL
SHEEAPVTLGHEFSGTVEEVGEGVTGLSVGDSVVVEPYFVCDECGPCRAGNYNLCTKLGF
IGLAGGGGGLSEKVVVDSRWVHPVGDIPLDEAALIEPLAVAYHAVGRSDVKAGDVAVVGG
AGPIGLLTAAVLKGLGVTTVVTELSAARKEKATSSGVADHVLDPSAVDVKARVLELTGGA
GADAAFECAGVNAVLDMMLDVVKPAGVVVNVSIWGRPATVDMQKIVLKEIDLRGTIAYRG
DHAAAIKLVQEGKVDLKPFITGRIALDDLVDKGFDTLIHHNDTAVKIIVHP
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagcacgattccacgcccgcgaggatcttcggatcgaagacattccggagccg
gagctgcgcccgggtgccgtgaagattgcaatcgcctggtgcgggatctgcggcacggac
ctccacgaattcctggaagggcccatctttaccccgccgcccggacagccccacacgctg
tcacatgaggaggccccggtcaccctgggacacgagttctccggcactgttgaggaagtg
ggcgagggcgttaccgggctctccgtcggcgacagcgtggtggtagagccctacttcgtc
tgtgacgaatgcggtccgtgccgggctggcaactacaacctgtgcaccaagctgggtttc
atcgggctggccggcggcggaggagggctcagcgaaaaggtcgtggtcgactcacgctgg
gtccatcccgttggtgacattccactcgacgaagccgcgctcatcgaaccgctagcggtg
gcctatcacgccgtcggccggagcgacgtgaaagccggggacgtcgccgtcgtcggcggt
gcgggccccatcggactgctcacggccgcagtcctgaaagggctgggcgtcaccaccgtg
gtgactgaactgtccgccgcgcgcaaggagaaagccacgtcttccggcgtcgcggaccat
gtcctcgaccccagcgcagtcgacgtcaaggcgcgggtgctggaactgaccgggggagca
ggtgcggacgccgcgttcgaatgtgccggagtgaacgccgtcctggacatgatgctcgac
gtcgtcaagcccgccggagtagtggtcaacgtatccatctggggacgcccggccaccgta
gacatgcagaagatcgtcctcaaggaaatcgaccttcgcggaacgatcgcctaccgcggg
gaccacgcggccgccatcaagcttgtccaggaaggcaaagtggacctcaaacccttcatc
acgggacggatcgccctggatgaccttgtggacaagggattcgacaccctgatccaccac
aacgacacggcggtgaagatcatcgtgcatccgtag

DBGET integrated database retrieval system