KEGG   Arthrobacter sp. FB24: Arth_1142Help
Entry
Arth_1142         CDS       T00421                                 

Definition
(GenBank) thymidine phosphorylase
  KO
K00758  thymidine phosphorylase [EC:2.4.2.4]
Organism
art  Arthrobacter sp. FB24
Pathway
art00240  Pyrimidine metabolism
art01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:art00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Arth_1142
Enzymes [BR:art01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     Arth_1142
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_3 PYNP_C Glycos_trans_3N
Motif
Other DBs
NCBI-ProteinID: ABK02536
UniProt: A0JU16
Position
1238756..1240078
Genome map
AA seq 440 aa AA seqDB search
MTQTPSNTEAFDAVDIIRIKRDRGVLSPAQIDWTIDAYTRGAIADEQMAALNMAILLNGM
DRAEISRWTAAMIASGERMDFSGLRRADGSVKPTSDKHSTGGVGDKITLPLAPLVAVFGV
AVPQLSGRGLGHTGGTLDKLEAIPGWRAGLSNDEMMAQLQNVGAVICAAGAGLAPADKKL
YALRDVTGTVEAIPLIASSIMSKKIAEGTGSLVLDVKVGSGAFMKDEARARELAETMVAL
GKDAGVNTVALLTNMNTPLGLTAGNSIEVEESVEVLAGGGPEDVVELTVRLAEEMLACAG
VHDADPRAALKDGRAMDVWNRMIEAQGGDPRAKLPVARESEVVYAPADGVLVELDALAVG
VAAWRLGAGRARKEDQVQAGAGVRLHAKPGAVVRAGEPLMTLLTDTPEKFERAKEALEGS
VVIAPEGSRPAQKLIIDRIA
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
gtgacacaaaccccaagcaacaccgaagcgttcgacgccgtcgacatcatccgcatcaag
cgggacaggggagtcctgagcccggcccagatcgactggaccatcgacgcctatacccgc
ggcgcgatcgccgacgagcagatggccgccctgaacatggccatcctgctcaacggcatg
gaccgcgcggaaatttcgcgctggaccgccgcgatgatcgcgtccggcgaacggatggac
ttctccggactgaggcgggccgacggcagcgtgaagccgacgtcggacaagcactccacc
gggggagtgggggacaagatcacgctgccgctggcaccgcttgttgctgtatttggcgtg
gctgttccacagctctccggccggggcctgggccacaccggcggcacactggacaagctg
gaagccatcccgggctggcgcgcagggctgagcaacgacgaaatgatggctcagctccaa
aacgtcggggcagtgatctgcgccgcgggtgccgggctggcccctgcggacaagaagctc
tatgccctgcgcgacgtcacgggaacggtggaagccatcccgctgattgcgtcctccatc
atgagcaagaagatcgcggagggcaccggctcactggtcctcgacgtcaaggtgggaagt
ggcgcctttatgaaggacgaggcccgcgccagggaactggccgagacgatggtggccttg
ggcaaggatgccggtgtcaacaccgtggcccttttgactaacatgaacacgccactgggc
ctgaccgccggaaactcgatcgaggttgaggaatccgtggaggtgctggccggcggcggt
ccggaagacgtcgtggaactgacggtccggctggcggaggagatgctcgcctgcgccggc
gttcatgacgccgacccgcgcgccgcgctcaaggacggccgggccatggacgtgtggaac
cgcatgatcgaggcacaaggtggggacccccgggccaagcttcccgttgccagggaatcc
gaagtcgtctacgcgccggccgacggtgtcctcgtggagctggatgcactggccgttggc
gtggccgcgtggcggctaggtgccggccgggcgcgcaaggaggaccaggtccaggcgggt
gccggcgtccggctgcacgccaagcccggtgccgtggtccgcgcaggcgagcccctgatg
acgctactgacggacaccccggagaagttcgagcgggccaaggaagccctcgaagggtcc
gtcgtcatcgcaccggagggctcccggccggcgcagaaactcatcatcgaccgcatcgcc
tga

DBGET integrated database retrieval system