KEGG   Arthrobacter sp. FB24: Arth_1255Help
Entry
Arth_1255         CDS       T00421                                 

Definition
(GenBank) FAD dependent oxidoreductase
  KO
K03333  cholesterol oxidase [EC:1.1.3.6]
Organism
art  Arthrobacter sp. FB24
Pathway
art01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:art00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    Arth_1255
Enzymes [BR:art01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     Arth_1255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GMC_oxred_C DAO FAD_binding_2 GMC_oxred_N NAD_binding_8 Pyr_redox_2 FAD_oxidored
Motif
Other DBs
NCBI-ProteinID: ABK02649
UniProt: A0JUC9
Position
complement(1385932..1388601)
Genome map
AA seq 889 aa AA seqDB search
MEPVVQGDDDPAESVDAVVVGSGFGGSVASYRLAAGGQSVVLMERGRAYPPGSFARTPSE
MGRNFWDPDKGLYGLFDAWTFRGLEGIVSSGLGGGSLIYANVLLRKDKNWFVQESPVPGG
GYESWPFSRQDLEPYYDAAEAMLRPVPYPYRDTPKTLAMEAAARALGLSITRPPIAVTFA
ASPGAAPARNQVLPPAPYGSVHGEGTVRTTCTLSGECDIGCNTGAKNTLDHNYLSAAKAA
GADIRTHHDVRGIRPLPGGGYEVRYVVHDPADTAPGLLREQLIHCRRLILAAGTFGTTFL
LLRNRASLPALSPALGTRFSGNGDLLGFVLDAKDPDGVTRTLSGSVGPVITTAIRTPDST
DGGDGRGYYIEDAGYPSFMNWLLETGQFRQVAKRAGKVMVQLLKDRLFQAQRSNISADLA
AALGDGRLSASSVPLLGMGRDIPDGVMTLQGGRLAINWTLATSAAYFGRMQATMQAIATE
LGGSFKQNPLWWSKRVITVHPLGGAPAGRNSSEGVCDSYGEVFGYPGLHVVDGAVMPGPV
GANPALTIAAFAERACDRILNGTGADRQRGGLDTPGFPPGNTGGVTFDDGITGYQPGPLR
ALVPDATKGAKAPAEEGTFVPRAASRSLGLPSAVSPEVGISPEMMLPESEALQEAEIEEE
TELAETGPSSVSFTEQMHGWFSAGVTDPEEGRSLGRDRSRRMMFELTITAADIDEFVRDP
LHPATAEGYVLADQFGGRLPVERGWFNLFVKDGPEPAGRKMLYRLWLRDPGGTPLTFVGH
KDVRNDAGFDVWGDTTTLYVTVLRGHVPSPDPKLPVSTAPQAAAPHGPAVVAGAGMLFIR
PWDFARQLTTFRVAGPNPASALAAFGKVFLGELWQVYGRRIHGRSAGRQ
NT seq 2670 nt NT seq  +upstreamnt  +downstreamnt
gtggaaccggtggtgcaaggcgacgatgatcccgcggagtcggtggacgccgtggtggtg
ggctccggcttcggcggatcggtagcgtcctaccggttggcggccggcggccagtccgtg
gtcctgatggaacggggcagggcctacccgccgggaagcttcgccaggacaccgtccgag
atgggccggaatttctgggatccggacaagggcctgtacggtctctttgatgcctggacc
ttcaggggcctggaaggaattgtctccagcggcctgggcggcggatccttgatctacgcg
aacgtgctgctgcgcaaggacaagaactggtttgtccaggaatcccccgttcccggcgga
ggctacgaaagctggccgttcagcaggcaggacctcgagccctattacgatgccgccgaa
gccatgctccgccccgtgccctacccttaccgggacacccccaagaccctggccatggaa
gccgccgcgcgcgcactcggactcagcatcacgcgaccgcccatcgccgtcacctttgcg
gcttcccctggtgcggctcccgcaaggaaccaggtgctgccgcccgccccgtatggaagc
gtccatggcgaggggacggtccgcaccacctgcaccctctccggcgaatgcgacatcggg
tgcaacaccggcgccaagaacaccctggaccacaactacctgtccgcggccaaggctgcc
ggcgcggacatccggacccaccacgacgtccgcggcatccgtccccttccgggaggcggc
tatgaagtccgatacgtcgtccacgatcccgccgacaccgcgcccgggctcctgcgcgaa
cagctaatccactgccgccggctcatcctcgccgccggaacgtttggcaccacgttcctg
ctgctgcgcaaccgcgcctcgcttcccgcgctgagccccgcactgggcaccaggttcagc
gggaacggggacctgctgggcttcgtcctggacgccaaggaccccgacggcgtcacgcgc
acgctgtcgggcagcgtggggccggtcatcaccacggctatccgcacgcccgactccacc
gacggcggcgacggccgcgggtactacatcgaagacgcaggctacccgtcgttcatgaac
tggctcctggaaaccggacagttccgccaggtggcgaagcgcgcgggcaaagtgatggtg
cagctcctcaaggaccggctcttccaggcccagcgctccaacatctccgccgatcttgcc
gcggccctgggagacggccggctgtcagcgtcctccgtgcccctgctcggcatgggccgg
gacataccggacggcgtgatgaccctccagggcggccggctggccatcaactggaccctc
gccacctcggccgcgtacttcggccggatgcaggccacgatgcaggcgatcgccacggaa
ctgggcgggagcttcaagcagaatccgctctggtggagcaaacgggtcatcaccgtgcat
ccgctgggcggcgccccggcaggacggaacagcagcgaaggcgtgtgcgattcctacggt
gaggtctttggctaccccgggctgcacgtggtggacggagccgtgatgcccggtccggtg
ggagccaaccccgccctgaccatcgccgcatttgccgaacgggcctgcgaccggatcctg
aacggaacgggagcggaccggcagcgcggcggcctggacactcccgggttcccgcccggc
aataccggcggcgtgactttcgacgacgggattaccggctaccagccggggccgcttcgc
gccttggtgcccgacgccacgaaaggtgccaaggccccggccgaagaaggcacgttcgtc
ccgcgggccgccagccgctcgctgggcctgccatccgcagtatccccggaggtgggcatc
tcccccgaaatgatgctccccgaaagcgaggcactgcaggaagctgagatcgaggaggaa
accgaactggccgaaacagggccgtcctccgtcagcttcaccgaacagatgcacgggtgg
ttcagcgccggcgtcacggaccctgaggagggacgcagcctgggccgtgaccgcagccgc
cggatgatgttcgaactcaccatcacggccgctgacattgacgagttcgtgcgtgatccg
ctccatccggcaactgctgagggctacgtcctggccgaccagttcggcggccgcctgcca
gtggaacggggctggttcaatctcttcgtcaaggacggccctgaacctgccggccggaag
atgctctaccggctctggctgcgcgatccgggcggcactccgctgactttcgtgggccac
aaggacgtccgcaacgatgcaggcttcgacgtctggggtgacaccaccacactgtacgtc
accgtcctgcgcgggcatgttccgtccccggacccgaagctgccggtctcaaccgctccg
caggcggccgccccgcacggccccgccgtggtggcgggcgcagggatgctgttcatccgg
ccgtgggacttcgcccggcaactgacaacgttccgcgtcgcgggaccgaaccctgcgagc
gccctggcagcattcggcaaggtctttcttggcgagctctggcaggtgtacggccgccgg
atacacggccggtccgccggccggcagtga

DBGET integrated database retrieval system