KEGG   Arthrobacter sp. FB24: Arth_1588Help
Entry
Arth_1588         CDS       T00421                                 

Definition
(GenBank) Polyphosphate glucokinase
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
art  Arthrobacter sp. FB24
Pathway
art00010  Glycolysis / Gluconeogenesis
art00520  Amino sugar and nucleotide sugar metabolism
art01100  Metabolic pathways
art01110  Biosynthesis of secondary metabolites
art01120  Microbial metabolism in diverse environments
art01130  Biosynthesis of antibiotics
art01200  Carbon metabolism
Module
art_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
art_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:art00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Arth_1588
   00520 Amino sugar and nucleotide sugar metabolism
    Arth_1588
Enzymes [BR:art01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     Arth_1588
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: ABK02982
UniProt: A0JVB2
Position
complement(1769515..1770318)
Genome map
AA seq 267 aa AA seqDB search
MAKKDDKSTKNAPLIGIDIGGTGIKGGIVDLKKGKLVGDRFRVPTPQPATPESVAETVAA
VVAELDARPDAPSPDSPIGVTFPGIIQHGVVHSAANVDKSWLNTDIDTLLTKRLGRPVEV
INDADAAGLAEARYGAGAGVSGTVLVITLGTGIGSAFIFNGKLVPNAELGHLEIDGFDAE
SKASAVARERDGLSWTEYSVLLQRYFSHVEFLFSPELFIVGGGISKRADEYLPHMKLRTK
IVPAELKNDAGIVGAAIEVALTHKLAK
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
ttggccaagaaggacgacaagtcaaccaagaacgccccgctgatcggaatcgacatcggc
ggaaccggaatcaagggcggcattgtcgacctcaaaaagggcaaactcgtgggcgaccgc
ttccgcgttccgacgccgcagcccgcgacgccggagtcggttgccgaaacggtcgcagcg
gtggtcgctgagctcgacgcccggccggacgcgccgtcccccgattcgccgatcggcgta
acgttccccggcatcatccagcacggtgtggttcattccgcagccaacgtcgataagtcc
tggctcaacacggatattgacacgctgctgaccaagcgcctgggccgcccggtggaggtc
atcaacgacgccgacgccgcgggtctcgccgaagcccgctacggagcgggagcgggtgtc
tccgggaccgtcctcgtgattacccttgggacgggcattggctcggccttcatcttcaac
ggcaagctggtcccgaacgccgaactcggacacctcgagatcgacggttttgacgccgag
agcaaggcctccgccgtggcacgtgaacgcgacggcctaagctggaccgagtacagcgtg
ctgctccagcgctacttctcgcatgttgaattcctgttctcccccgaactgttcatcgtc
ggcggcggcatctccaagcgggccgacgagtacctgccgcacatgaagctgcgcacgaag
atcgtcccggccgagctcaagaacgacgccggcattgtgggcgccgccatcgaagttgca
ctgacgcacaaactggccaagtag

DBGET integrated database retrieval system