KEGG   Arthrobacter sp. FB24: Arth_3013
Entry
Arth_3013         CDS       T00421                                 

Definition
(GenBank) GCN5-related N-acetyltransferase
  KO
K15520  mycothiol synthase [EC:2.3.1.189]
Organism
art  Arthrobacter sp. FB24
Brite
KEGG Orthology (KO) [BR:art00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Arth_3013
Enzymes [BR:art01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.189  mycothiol synthase
     Arth_3013
SSDB
Motif
Pfam: Acetyltransf_1 Acetyltransf_7 FR47 Acetyltransf_10 Acetyltransf_9 Acetyltransf_3 Acetyltransf_CG Acetyltransf_8 GNAT_acetyltran Acetyltransf_4 Acetyltransf_13 Acetyltransf_6
Other DBs
NCBI-ProteinID: ABK04392
UniProt: A0JZC2
Position
3380282..3381253
AA seq 323 aa
MSPAHPENWPVLVVKGGVDDELLRDFTALAAAAEESDGNPPLSEQTFVTLRAGESGTHSL
LSLALYAPDEESDPATAQDLAGFAVVVEEADGTGVLELAVHPSYRNQGVADRLVATLKAS
RGFDGLKAWSHGNHEAAADLAAKYGYAPIRELWKMRLTASDAELPDAALPDNVSLRAFIP
GQDEEAWLAANKAAFSHHPEQGNMTRQDLAARMAEDWFDPAGFLLAVDPSGRILGFHWTK
VHPGHGGHPAIGEVYVVGVTPEAQGMGLGKALTVAGIKYLQDKGLHAVVLYTDADNTPAV
SLYRRLGFTRWDADVMYGPKNGG
NT seq 972 nt   +upstreamnt  +downstreamnt
atgagtcctgcgcatcccgagaactggcccgtgctcgtcgtcaagggcggagtggacgat
gaactgctcagggatttcacagccctcgccgcggccgccgaagagtcggacggaaaccct
cccctgtccgagcagactttcgtgaccctccgcgccggcgagtcgggaacccattcgctc
ctgagcctggcgctctatgcgcccgatgaggaatcggatcccgccaccgcacaggacctc
gccggcttcgcggtggtggtggaggaagcggacggcacaggtgtgctggaactggcggtg
catccgagctaccggaaccagggcgtggcagacaggctggttgccacgctcaaggcatca
cggggtttcgacgggctcaaggcgtggtcccacgggaaccatgaggcagcagcggacctt
gcggccaagtacggttacgcccccatccgggagttgtggaagatgcggctcacagcatct
gacgctgaactgcccgacgccgccctcccggacaacgtgagcctgcgggccttcatcccc
gggcaggacgaggaggcgtggctggcagccaacaaggccgccttcagccaccatccggag
caagggaatatgacgcggcaggatctggccgcccggatggccgaggactggttcgatccc
gccggcttcctcctcgcggtcgacccgtcggggcggatcctcggcttccactggaccaag
gtgcacccgggccacggcggccatcccgccatcggtgaggtctacgtggtgggtgtgacc
cccgaagcccagggcatgggactgggtaaggccctcaccgtggccggcatcaagtacctg
caggacaagggccttcacgcggtcgtgctctacacggatgcggacaatacgccagccgtt
tcgctgtaccgccgactcggctttacgcggtgggatgcggacgtgatgtacggacccaaa
aacggcggttaa

DBGET integrated database retrieval system