KEGG   Arthrobacter sp. FB24: Arth_3087Help
Entry
Arth_3087         CDS       T00421                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
art  Arthrobacter sp. FB24
Pathway
art00010  Glycolysis / Gluconeogenesis
art00071  Fatty acid degradation
art00350  Tyrosine metabolism
art00625  Chloroalkane and chloroalkene degradation
art00626  Naphthalene degradation
art01100  Metabolic pathways
art01110  Biosynthesis of secondary metabolites
art01120  Microbial metabolism in diverse environments
art01130  Biosynthesis of antibiotics
art01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:art00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Arth_3087
  Lipid metabolism
   00071 Fatty acid degradation
    Arth_3087
  Amino acid metabolism
   00350 Tyrosine metabolism
    Arth_3087
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Arth_3087
   00626 Naphthalene degradation
    Arth_3087
Enzymes [BR:art01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Arth_3087
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 AlaDh_PNT_C 3HCDH_N 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: ABK04466
UniProt: A0JZJ6
Position
complement(3457913..3458935)
Genome map
AA seq 340 aa AA seqDB search
MTTTMQAAVVTEFGKDLQIQSLPVPTPGRGEALVKVITTGVCHTDLHAAEGDWPVKPTPP
FIPGHEGVGEVVALGEGVTDLAVGDLVGNAWLWSACGDCQYCRTGWETLCEAQKNAGYSV
DGSFGEYMLVDTRFAARIPAGSDPVEVAPVLCAGVTVYKGLKMTEAKPGQWVTISGIGGL
GHIAVQYAVAMGLRVAAVDIADDKLALAKKHGAELTVNALHEDPAEVIQRETGGCHGVLV
TAVHPSAFGQAIGMARRGGTIVFNGLPPGDFPAPIFEIVLKGLTVRGSIVGTRQDLEEAL
DFYAQGKIHPTVSTRELSEVNAVLDEMKHAKIDGRVVIKY
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgacgacgacaatgcaagcagccgtagtaactgaattcggaaaagacctccagatccaa
tccctccccgttcccactccgggccgtggcgaggcgctggtcaaggtcatcaccaccggg
gtctgccataccgaccttcacgccgcggagggtgactggccggtcaagccgacaccgccc
ttcatcccgggccacgaaggcgtgggcgaagtggtcgccctcggcgagggtgtcaccgac
ctggccgtcggggacctagtgggcaacgcctggctctggtccgcctgcggcgactgccag
tactgccgcacgggctgggaaaccctctgcgaagcgcaaaagaacgccggctatagcgtg
gacggctcgttcggcgagtacatgctcgttgacacccgcttcgccgcccggattccggcg
ggctccgaccccgtggaggtcgccccggtgctctgtgccggcgtcacggtctacaaggga
ctgaagatgaccgaggccaagccgggccagtgggtcaccatttcgggtatcggcggcctg
ggccacatcgccgtgcagtacgccgtggccatgggcctgcgggtggccgccgtggatatc
gcggacgacaaactcgccctggccaagaaacacggcgctgagctcaccgtcaacgcgttg
cacgaagatccggcggaagtcatccagcgcgaaaccggaggttgccatggagtcctggtc
acggcggtgcacccgtcagctttcggacaggccatcgggatggcccgccgcggcgggacg
attgtgttcaacggcctgccgccgggcgacttcccggcaccgatcttcgagattgtgctc
aagggcctgaccgtccgcggctcgatcgtgggcacccggcaggacctggaggaggccctg
gatttctacgcccagggcaagatccaccccacggtatccacccgtgaactctcggaagtc
aatgcggttcttgacgagatgaagcacgccaagatcgacggccgcgtggtcatcaaatac
tga

DBGET integrated database retrieval system