KEGG   Arthrobacter sp. PGP41: C3B78_01480Help
Entry
C3B78_01480       CDS       T05450                                 

Definition
(GenBank) phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
arth  Arthrobacter sp. PGP41
Brite
KEGG Orthology (KO) [BR:arth00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    C3B78_01480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AUZ36454
UniProt: A0A2L0R3G8
Position
complement(323761..324753)
Genome map
AA seq 330 aa AA seqDB search
MVVLLSAAFAFLNGFRDASTSVALAVRTRALTPSVAVLLAAFFNFVGALLSAGLAVAISR
AWISLPPGPQGLSILVAGLASACAWGILLWWRGIPASSTHALVGGLAGAGLASLAVGGTG
VGGVDQSLLFQVVLPLVLSPLVAYSGAFMLVYPATWAARYSQPNVVNHRFRRSQAVAAGA
VAFGHGLQDGQRVSAVLLLALLAAGYADGGSLPLWVMLLTAVMIAAGTMFGGWRISHTIG
YRITRVDPLRGSVAQTFSAVMLFVGAIGLHWPLSTTHTVTSAVLGAGENQHFSVTNRKLV
IRIVGLWVLTPAATAALAFVLALALTPVAG
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atggtggtcctgctgtctgcggcgttcgccttcctcaacggcttccgtgacgcgtccacc
tcggtcgcgcttgcggtccgcacaagggcactcacccccagcgtcgcagtgctgctggca
gccttcttcaacttcgttggcgccctcctgagcgccggcctggctgtggccatcagccgg
gcatggatcagccttcctccggggccgcagggcctcagcatcctggtggccgggctggcc
agcgcgtgcgcatggggaattttgctgtggtggcgcggcatccccgcctcatccacccat
gccctggtgggcggacttgccggcgccggactggccagcctggcggtgggcggcaccggc
gtcggaggggtggaccagtccctgctcttccaggtagtacttccgctggtgctgtccccg
ctcgtcgcgtacagcggcgccttcatgctggtgtatccggccacctgggccgcccgctac
tcccagcccaatgtggtcaaccaccgcttccgccggagccaggcagtggcggccggggcc
gtggctttcggacacggcctgcaggacgggcagcgggtgagcgccgtgctgctgctggcg
ctgttggcggccgggtatgccgacggcggctcgttgcccctgtgggtgatgctgctgaca
gcggtgatgatcgccgccgggaccatgttcggcggctggcggatctcgcacacaatcggg
tacagaattacccgggtggatccgctgcgcgggtctgtggcccagactttcagcgccgta
atgctttttgtgggtgccattgggctccattggccgttgtccaccacacacactgtgact
tcggcggtcctcggggcgggagagaaccagcatttttccgtgactaaccggaagctggtg
atccggatcgtggggctctgggtcctcacccccgccgccacggctgcactggcattcgtg
ctggctttggcgctcaccccggtggctggctga

DBGET integrated database retrieval system