KEGG   Arthrobacter sp. PGP41: C3B78_03455Help
Entry
C3B78_03455       CDS       T05450                                 

Definition
(GenBank) cysteine--tRNA ligase
  KO
K01883  cysteinyl-tRNA synthetase [EC:6.1.1.16]
Organism
arth  Arthrobacter sp. PGP41
Pathway
arth00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:arth00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    C3B78_03455
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:arth01007]
    C3B78_03455
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:arth03016]
    C3B78_03455
Enzymes [BR:arth01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.16  cysteine---tRNA ligase
     C3B78_03455
Amino acid related enzymes [BR:arth01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   C3B78_03455
Transfer RNA biogenesis [BR:arth03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    C3B78_03455
 Prokaryotic type
    C3B78_03455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1e DALR_2 tRNA-synt_1g tRNA-synt_1 tRNA-synt_1f CP_ATPgrasp_1
Motif
Other DBs
NCBI-ProteinID: AUZ33621
UniProt: A0A2L0QVD3
Position
723617..725092
Genome map
AA seq 491 aa AA seqDB search
MTLRFYDTASAEVRNFVPIVEGKASLYYCGATVQGMPHVGHIRSAIAFDQLTRWLVHRGL
RVTVVRNVTDIDDKILAKSEASFAPGFTPEPGEVAEEEWWALAYRYEQEFLKAYDTLGVS
RPTYEPRATGHIPEMHALIQQLIDRGHAYPALDDSGDVYFDVRSWSKYGALTRQNIDDMQ
AAPDVEPQFSNRKKDPRDFALWKGSKEGEPTTASWASPWGAGRPGWHLECSAMVTKYLGA
EFDIHGGGLDLRFPHHENELAQSQAAGHPFANFWMHNGMVTYEGEKMSKSIGNTVSPAEM
LQLASPRVVRYYLGQAHYRSVLDYRPTSLQEAAAAVERIDGFIAKATARFGTGSGSVAGP
DGSSADTLRTFAEAMDDDLNVPRALAALHETVRAGNTALAEGDDPAARLALDTVSVMTDV
LGLNAVAGTDAGNAKDKAALDVLVQAQLEARAAARAEKNWAASDAIRDTLTAAGILVEDG
PDGATWSLKRD
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
gtgaccctgcgcttctatgacactgcctccgccgaagtccggaacttcgtccccatcgtc
gagggcaaagccagcctctactactgcggggccaccgtgcagggcatgccccacgtaggc
cacatccgctcggccattgcctttgaccagctcacccgctggttggttcaccgcgggctc
cgggtcacggtggtccgaaacgtcacggacatcgacgacaaaatcctggccaagtccgag
gcctccttcgcgccgggcttcaccccggaacctggcgaagtggccgaggaagagtggtgg
gcactcgcttaccgctatgagcaggaattcctcaaggcttacgacacgcttggcgtttcc
cggccaacgtacgagccccgcgccaccggacacatcccggagatgcacgccctcatccag
cagctgatcgaccgcggccacgcctatcccgccctggacgactccggcgatgtctacttc
gacgtgcgttcctggagcaagtacggcgcactgacccggcagaacatcgacgacatgcag
gcagccccggacgtcgaacctcaattcagcaacaggaagaaggacccgcgcgacttcgcc
ctgtggaaggggtccaaagaaggagagccgacgacggcgagctgggcttccccctggggt
gccggccgcccgggctggcacctggaatgctccgccatggtcaccaagtacctcggcgcc
gagttcgatatccatggcggcggccttgacctccggttcccgcaccacgaaaacgagctg
gcccagtcgcaggcggcgggccacccgttcgccaacttctggatgcacaacggcatggtg
acctacgagggcgaaaaaatgtccaagtccatcggcaacaccgtcagccctgccgagatg
ctgcaactggcatccccccgcgtggtccgctactaccttggccaggcccactaccgctca
gtgctggactaccggcccacgtccctccaggaggccgcggccgccgtcgaacgcattgat
ggttttattgccaaggcgaccgcccggttcggtaccggctccggctcagttgccggcccc
gacggctcctccgccgataccttgcgcacgttcgccgaggccatggacgacgacctgaac
gtcccgcgtgcgctggccgccctgcacgagacggtccgggccggcaacaccgcccttgcc
gaaggcgatgaccccgccgcccgtctcgcgttagacacggtgtcagtcatgaccgacgtc
ctggggctgaatgccgtggcaggtaccgatgccggcaacgccaaggacaaggccgccctg
gacgtcctggtgcaggcccagctggaagcccgtgccgcggcaagggcggagaagaactgg
gcggcatcagatgccatccgggacaccctcaccgctgccggcatcctggtggaggacggc
ccggacggcgcaacctggagcctgaagcgggactga

DBGET integrated database retrieval system