KEGG   Arthrobacter sp. PGP41: C3B78_07865Help
Entry
C3B78_07865       CDS       T05450                                 

Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
arth  Arthrobacter sp. PGP41
Pathway
arth00260  Glycine, serine and threonine metabolism
arth01100  Metabolic pathways
arth01110  Biosynthesis of secondary metabolites
arth01120  Microbial metabolism in diverse environments
arth01130  Biosynthesis of antibiotics
arth01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:arth00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    C3B78_07865
Enzymes [BR:arth01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     C3B78_07865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_5
Motif
Other DBs
NCBI-ProteinID: AUZ36580
UniProt: A0A2L0R3T9
Position
complement(1749308..1750393)
Genome map
AA seq 361 aa AA seqDB search
MTTTAETAAGIRLHDPNVRGFASDNYSGVHPEVLAALAAANDGHQVSYGEDDYTARLQQL
MEDHFGPGIECFPVFNGTGANVLSLQSLLPRWGAVVCASTAHINMDENGAPERMGGIKLL
HVPTPDGKLTPELIDREAWGWGDEHRAQPLAVSITQTTELGTCYTPEEVRAIADHAHAKG
MKLHMDGARLANAAAHLRIPLRAFTRDAGVDILSFGGTKNGLLFGEVVVALNPEAAHGLV
YLRKMDMQLASKMRFLSAQFIALLEGDLWLRSAAHANAMAARLRAAVDTIDGVRPTQETE
SNGVFAVLPEGVADRLRASFRFYDWNEATREVRWMCSFDTTEEDVDAFVAALRRELHNGG
N
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgacgacaaccgccgaaaccgccgccggcatccgcctccatgatccgaacgtgcggggt
ttcgcctcggacaactactcgggcgtccatcccgaggtgctggctgccctggcggccgcc
aacgacggccaccaggtctcctacggcgaggacgactacacggccaggctgcagcagctg
atggaggaccacttcggcccaggcatcgagtgctttcccgtcttcaacggcaccggcgcc
aacgtcctttcactgcagtcactgctcccccgctggggcgccgtggtctgcgcctccacc
gcccacatcaacatggatgagaacggcgcgccggaacgcatgggcggcatcaagctgctg
catgtccccacgccggacggcaagctcacgcccgaactgattgaccgggaggcctggggc
tggggggacgagcaccgcgcccagccgctggcggtgtccatcacccagaccacggaactc
ggcacctgctacacgccggaggaagtccgggccattgctgaccatgcccatgccaaggga
atgaagctgcacatggacggcgcccggctggccaacgccgctgcccacctccggattccg
ctgcgggccttcacgcgcgacgccggggtggacatcctgtcctttggcggcaccaagaac
ggcctgctgttcggcgaagtggtggtggcactgaacccggaagcggcccacgggctcgtc
tacctgcgcaagatggacatgcagctggcctccaagatgcgcttcctgtcagcgcagttc
atcgcgctcctggaaggtgacttgtggttgcggtccgccgcgcacgccaacgccatggcc
gcccggctccgcgccgccgtcgacaccatcgacggcgtccggcccacccaggagaccgaa
tccaacggcgtttttgccgtcctccccgaaggcgtggccgacaggctgcgcgcgtcgttc
cgcttttacgattggaatgaagccacgcgcgaggtgcgctggatgtgttccttcgatacc
accgaagaggatgtggatgccttcgttgccgcactccgccgggaactgcacaatggcggg
aactga

DBGET integrated database retrieval system