KEGG   Arthrobacter sp. PGP41: C3B78_09770Help
Entry
C3B78_09770       CDS       T05450                                 

Definition
(GenBank) trans-aconitate methyltransferase
  KO
K00598  trans-aconitate 2-methyltransferase [EC:2.1.1.144]
Organism
arth  Arthrobacter sp. PGP41
Brite
KEGG Orthology (KO) [BR:arth00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    C3B78_09770
Enzymes [BR:arth01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.144  trans-aconitate 2-methyltransferase
     C3B78_09770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_25 Methyltransf_31 Methyltransf_11 Methyltransf_23 Methyltransf_12 MTS Methyltransf_32 Methyltransf_4 Ubie_methyltran TehB FtsJ NodS PrmA RrnaAD CMAS MetW
Motif
Other DBs
NCBI-ProteinID: AUZ36613
UniProt: A0A2L0R3Z6
Position
2156556..2157335
Genome map
AA seq 259 aa AA seqDB search
MKWDPAKYVQFGDYRDRPFFDLTGRVRADRPVQVVDLGCGPGNLTATLADRWPGSDVVGL
DSSEEMLAKAAGQSEENPSLRFELADISEWKPSGQTDVVVSNAALQWLPGHQDMMRTWLD
ALRPGAWFALQVPGNFNAPSHALLRGLAGAQRWAPKLGGVLRGGESVGEPAEYLRLMLDA
GFSADAWETTYLQVLPGRDAVLEWVRGTALRPVLAALSPAEGAEFEAEYAAALREAYPQT
EHGTVFPFRRIFAVGCKNQ
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgaagtgggatccggcgaaatatgtccagttcggggactaccgggaccggccctttttc
gacctgaccggcagggtccgggcggaccggcccgtccaggtggtggacctgggctgcggg
ccagggaacctgacggccacgctcgcggaccgctggcccggttccgacgtggttggcctt
gattcatcggaggagatgctcgccaaagccgccgggcagtcggaagaaaacccgtccctg
cgcttcgagctggcggacatttcggagtggaagccctcggggcagaccgatgtggtggtc
agcaatgctgccctgcagtggctgccgggccaccaggacatgatgcggacgtggctggat
gccctgcgccccggtgcctggttcgcgctccaggtcccggggaacttcaacgccccgtcc
catgcgttgttgcgcgggctggcgggcgcacaacggtgggcgccgaagctcggcggggtg
ctgcggggcggcgagtcggtgggcgagcctgcggagtacctccgtctcatgctcgacgcc
gggttctcggctgatgcctgggagacaacctaccttcaggtgctgcccggcagggatgcc
gtcctggagtgggtccgcggcacggcgctccgccccgtccttgccgccctttccccggcg
gagggcgcggaattcgaggcggagtacgcagccgcgctgcgggaagcctatccacaaacg
gagcatggaaccgtctttccgtttcgaaggatctttgccgtggggtgcaagaaccagtga

DBGET integrated database retrieval system