KEGG   Arthrobacter sp. PGP41: C3B78_18895Help
Entry
C3B78_18895       CDS       T05450                                 

Definition
(GenBank) mannitol-1-phosphate 5-dehydrogenase
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
arth  Arthrobacter sp. PGP41
Pathway
arth00051  Fructose and mannose metabolism
arth01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:arth00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    C3B78_18895
Enzymes [BR:arth01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     C3B78_18895
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh Sacchrp_dh_NADP UDPG_MGDP_dh_N ApbA
Motif
Other DBs
NCBI-ProteinID: AUZ36301
UniProt: A0A2L0R321
Position
complement(4122054..4123217)
Genome map
AA seq 387 aa AA seqDB search
MKAVHFGAGNIGRGFVGLLLHDAGYEVVFADVAEDLISQLAAADSYAVHEVGENPAVRTV
TNFRALNSTTQEAELVAEIATADIVTTAVGPHILKFVAPVIARGIVARGPGLPPLEVMAC
ENAINATDILAKEVASQPGAAAGALDGKAVFANTAVDRIVPNQEPGQGLDVTVETFYEWV
IDRTAFGDSAPVIPGATFVDDLSPYIERKLFTVNTGHASAAYFGFEAGLAKISEAMADQD
VAEDVRAVLEETKQLLVSKHGFSNDEQEAYVQKILVRFSNPYLPDTVHRVGRAPLRKLSR
HERFIGPAAELAERGIVPEALLGAIAAALRFNDPADAEATELAGILASSSPADATARITG
LEPDHPLFNAVATLVEERQAEAAKAPA
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
gtgaaggctgtacatttcggggccggaaacatcggccgcggttttgtcgggctgctcctg
cacgacgccggctatgaggtggtgttcgcggacgttgccgaggacctcatcagccagctc
gctgcagcggacagctacgcggtccacgaggtgggggagaaccctgccgtgcggacagtc
accaatttccgggcgctgaactccaccacgcaggaagcggagctcgtcgcggaaatcgcg
acggcggatatcgtcaccaccgcggtgggcccgcacatcctgaagttcgtggcgcccgtc
attgcccggggcatcgtggcaaggggccccggtcttccgccgctggaggtgatggcgtgc
gagaacgctatcaacgccacggacatcctcgccaaggaggttgcctcccagccgggggca
gccgccggggcgctggacgggaaagccgtgtttgcgaacaccgcggtggaccggattgtg
cccaaccaggaaccagggcagggcctggacgtcacggtggagaccttttacgaatgggtc
atcgaccgcactgccttcggtgattccgcaccggtcatccctggggccacctttgtggat
gacctctcgccgtacatcgagcggaagctgttcactgtcaataccggccacgcgtcggcc
gcctacttcgggttcgaggcgggcctggcgaagatctccgaggccatggccgaccaggac
gtggccgaggatgtccgggcggtgctggaggaaaccaagcagctcctggtgagcaagcac
ggtttcagcaacgacgagcaggaagcctacgtccagaaaatcctggtccggttctccaac
ccctacctgccggacaccgtccaccgggtgggccgtgccccgctgcggaagctaagccgg
cacgaacggttcatcggtcccgccgccgaactcgcggaacgcggcattgtgccggaggcg
ctcctgggcgccatcgccgcagcgctgcggttcaacgatcccgccgacgccgaggccacg
gaactggccggcatcctggcctcctccagcccggcggacgctaccgcccgcattaccggc
ctggaaccggaccatccactgttcaacgccgtggcaaccctggtggaagagcggcaggca
gaggcggccaaggccccggcctga

DBGET integrated database retrieval system