KEGG   Arthrobacter sp. PAMC25564: E5206_05990Help
Entry
E5206_05990       CDS       T06052                                 

Definition
(GenBank) acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
artp  Arthrobacter sp. PAMC25564
Pathway
artp00430  Taurine and hypotaurine metabolism
artp00620  Pyruvate metabolism
artp00640  Propanoate metabolism
artp00680  Methane metabolism
artp01100  Metabolic pathways
artp01120  Microbial metabolism in diverse environments
artp01200  Carbon metabolism
Module
artp_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:artp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    E5206_05990
   00640 Propanoate metabolism
    E5206_05990
  09102 Energy metabolism
   00680 Methane metabolism
    E5206_05990
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    E5206_05990
Enzymes [BR:artp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     E5206_05990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase
Motif
Other DBs
NCBI-ProteinID: QCB96532
UniProt: A0A4P7SQ65
Position
1314209..1315381
Genome map
AA seq 390 aa AA seqDB search
MLVLVINSGSSSLKYQVRDVAAGNVLTGGLIEKIGTGGGPADHAEALELVAAAIHEVLGA
RKLDAVGHRVVHGGERFGEPILVDFEITRAIEQLSPLAPLHNPAHVLGIRAILKKWPELP
QVAVFDTAFHRTMPERAWRYAVPHELYARHGIRRYGFHGTSHEYVAHRTAALLDLPLEEF
DGVIAHLGNGASVTAIQGGRSVDTSMGFTPLEGLVMGTRSGDLDPSILVFLGRAGWSTDR
LDDMLNRKSGLKALAGNNDMRSVVEAAEAGNERAAMALDVASYRLAKYIGGYHVAVNGAK
AIAFTGGIGENSQAFRALVVDRLGALGVGLDARLNRVRSSEPRVISTADSAIPVLVVPTD
EERAIAEATADVVSRSAVNRSAVNRSAVAP
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgctcgtgctcgtgatcaattccggttcatcctcgctcaagtaccaggtccgcgacgtc
gcggccggaaacgtgctcaccggggggctgatcgagaagatcggcaccgggggagggccc
gcagaccatgccgaggcgctggagctggtggccgccgccatccacgaggtgctgggggcg
cggaagctcgacgccgtcggacaccgggtggtgcacggcggcgagcgcttcggcgagccg
atcctggtggacttcgagatcacccgcgccatcgagcagctcagcccgctcgcgccgctg
cacaacccggcacacgtgctgggcatccgggcgatcctcaagaagtggccggagctgccg
caggtggccgtgttcgacaccgccttccaccgcaccatgcccgagcgtgcctggcggtac
gccgtcccgcacgagctgtacgcgcgccacgggatccgccgctacggcttccacggcacc
tcgcacgagtacgtggcgcaccgcacggcggcgctgctggatctgccgctggaggagttc
gacggcgtgatcgcccacctgggcaacggcgcctccgtcacggccatccagggcggcagg
tccgtggacacctccatgggcttcacccccctggagggcctggtgatggggacccgctcg
ggggacctggatccgtccatcctggtgttcctgggccgggcgggctggtcgacggaccgg
ctggatgacatgctcaaccgcaaatccgggctcaaggccctggccggcaacaatgacatg
cgctccgtggtggaagccgccgaggccgggaacgaacgggccgcgatggcgctggatgtg
gcctcctaccggctggccaaatacatcggcggctatcacgtggccgtcaacggggcgaag
gccatcgcgttcacgggcggcatcggcgagaactcccaggccttccgcgccctcgtggtg
gaccggctgggcgccctgggcgtcgggctcgacgcccgtctgaaccgcgtgcggtcttcg
gagccgcgggtgatttccaccgcggattcggccatccccgtcctggtggtgcccaccgac
gaggagcgcgccatcgcggaggccaccgccgacgtcgtcagccgttcagcggtcaatcgt
tcagcggtcaatcggtcagcggttgcgccgtag

DBGET integrated database retrieval system