KEGG   Arthrobacter sp. PAMC25564: E5206_09660Help
Entry
E5206_09660       CDS       T06052                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
artp  Arthrobacter sp. PAMC25564
Pathway
artp00450  Selenocompound metabolism
artp00970  Aminoacyl-tRNA biosynthesis
artp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:artp00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    E5206_09660
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    E5206_09660
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:artp01007]
    E5206_09660
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:artp03016]
    E5206_09660
Enzymes [BR:artp01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     E5206_09660
Amino acid related enzymes [BR:artp01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   E5206_09660
Transfer RNA biogenesis [BR:artp03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    E5206_09660
 Prokaryotic type
   Other AARSs
    E5206_09660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1 tRNA-synt_1f Fusion_gly
Motif
Other DBs
NCBI-ProteinID: QCB97167
UniProt: A0A4P7SUD2
Position
2090231..2091790
Genome map
AA seq 519 aa AA seqDB search
MSSSAKTPFYITTAITYPNGVPHIGHAYEYIATDAMARFKRLDGYDVFFLTGTDEHGMKI
AQTAEKEGISPKELVNRNAEVYKAAHAALGISYDRFIRTTDADHYAASQAIWKKMEANGD
IYLSKYEGWYSVRDEAYYVEDETVVKDDGVRYSRETDTEVTWTAEESYFFKLSAYQDKLL
AMYEAHPDFGAPQYRFNEVISFVRGGLEDLSISRTSFDWGVPVPGNDQHVMYVWVDALTN
YLTGVGYPDLESESFRKYWPADVHVIGKDISRFHAIYWPAFLMSAGLELPKRVMIHGFLQ
NNGVKMSKSLGNVVAPADFVAQYGLDQVRFFLLREVPFGADGNYNHEAIVGRMNSDLANN
FGNLAQRSLSMVAKNCEGRVPAPGAFSAEDTALLAQANGLLDSARVAFEKQEFSRALEAI
WGVLGDSNAYFADQAPWVLRKTDVGRMKTVLYVTLEVLRIVAILVQPVMPTATAAILDTL
GQAEGDARQFTALGTPIAAGTPLPAPAPVFPKYEEPAEA
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
gtgtcgtcttcagctaaaaccccgttctacatcaccacggccatcacgtaccccaacggc
gtgccgcacatcggccacgcctatgaatacattgccaccgatgcgatggcccgcttcaag
cggctggacggctacgacgtcttcttcctgaccggcacggacgagcacggcatgaagatt
gcccaaacggcagagaaagagggcatctcgcccaaggagctggtgaaccgcaacgcggag
gtctacaaggccgcccacgcggccctggggatctcctatgaccggttcatccgcaccacg
gacgccgatcactacgcggcgtcacaggcaatctggaagaagatggaagccaacggcgac
atctacctgtccaagtacgaaggctggtactccgtccgcgacgaagcgtattacgtcgag
gacgagaccgtggtgaaggatgacggcgtccgctactcgcgcgaaacggacaccgaggtg
acctggacggcggaggagagctacttcttcaagctctccgcctaccaggacaaactgctg
gcaatgtacgaggcccaccctgatttcggcgccccgcagtaccgattcaacgaggtcatc
agcttcgtccgcggcggcctcgaggacctgtccatcagccgtacgagcttcgactggggt
gtcccggtgcccggcaatgaccagcacgtgatgtacgtctgggtggatgcgctgaccaac
tacctcaccggagtcggctacccggaccttgagtcggagtccttcaggaagtactggccc
gccgacgtccacgtcatcggcaaagacatctcgcggttccatgccatctactggcccgcc
ttcctgatgagcgccgggctggaactgcccaagcgggtcatgatccacggcttcctgcag
aacaacggcgtcaagatgtccaagtcactgggaaacgtcgtggcgccggcggacttcgtg
gcccaatacggcctcgaccaggtccggttcttcctcctgcgcgaggtgccgttcggcgcc
gacggcaactacaaccacgaggcaatcgttggccggatgaactcggacctcgccaacaac
ttcggcaacctcgcccagcggtccctgtccatggtggccaagaactgcgaaggccgcgtt
cccgctccgggcgccttcagtgccgaggacaccgcgctcttggcccaggccaacgggctg
cttgacagcgcgcgtgtagccttcgagaagcaggaattcagccgcgccctggaggcaatc
tggggcgtcctcggtgactccaacgcctacttcgccgaccaggccccgtgggtcctgcgc
aagaccgacgtcgggcgcatgaagaccgtgctctacgtgacgctcgaggtgctgcggatt
gtggccatcctggtccagccggtcatgccgacggcgaccgcggccatcctggacaccctc
ggccaggccgagggcgatgcccggcagttcacggcccttggaactcccatcgccgcgggt
acgcccctgccggccccggccccggtcttcccaaagtacgaggagcccgccgaggcatag

DBGET integrated database retrieval system