KEGG   Arthrobacter sp. PAMC25564: E5206_12405Help
Entry
E5206_12405       CDS       T06052                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
artp  Arthrobacter sp. PAMC25564
Pathway
artp00010  Glycolysis / Gluconeogenesis
artp00053  Ascorbate and aldarate metabolism
artp00071  Fatty acid degradation
artp00280  Valine, leucine and isoleucine degradation
artp00310  Lysine degradation
artp00330  Arginine and proline metabolism
artp00340  Histidine metabolism
artp00380  Tryptophan metabolism
artp00410  beta-Alanine metabolism
artp00561  Glycerolipid metabolism
artp00620  Pyruvate metabolism
artp00625  Chloroalkane and chloroalkene degradation
artp00903  Limonene and pinene degradation
artp01100  Metabolic pathways
artp01110  Biosynthesis of secondary metabolites
artp01120  Microbial metabolism in diverse environments
artp01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:artp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    E5206_12405
   00053 Ascorbate and aldarate metabolism
    E5206_12405
   00620 Pyruvate metabolism
    E5206_12405
  09103 Lipid metabolism
   00071 Fatty acid degradation
    E5206_12405
   00561 Glycerolipid metabolism
    E5206_12405
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    E5206_12405
   00310 Lysine degradation
    E5206_12405
   00330 Arginine and proline metabolism
    E5206_12405
   00340 Histidine metabolism
    E5206_12405
   00380 Tryptophan metabolism
    E5206_12405
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    E5206_12405
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    E5206_12405
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    E5206_12405
Enzymes [BR:artp01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     E5206_12405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DUF1487 PepSY
Motif
Other DBs
NCBI-ProteinID: QCB97620
UniProt: A0A4P7ST86
Position
complement(2657822..2659345)
Genome map
AA seq 507 aa AA seqDB search
MTAQSSDLISRLEDSDGLTQYGLYIGGAFTGPEDGEYFDTVNPYTGEVWARIAKGGPADV
SRAVASASEAFKSWSRTKPQHRGKLLMDLADLIEANSEHLARIEVRDNGKLYAEMAAQTR
YMAGWYRYYGGMADKIEGSVIPSDKPNILNYTRLEPLGPIAMITPWNSPLLLLAWKLPAA
LAAGNTVVIKPSEFTSASTLEFMTLFEKAGFPPGVVNTVTGFGQDVGAPLVSHPNIVKVA
FTGSEAAGQKIYENAASQFKHVSLELGGKSPNIVFEDADLDAAAAGVISGIFAATGQTCI
AGSRLLVQRSIHDDFVQRVVALAEQAKIGDPMLPDTHVGPVTTRPQFEKVLDYIDIARRE
GATCVLGGAAYTGEGASGGQFVQPTIFTNVRNEMRIAQEEVFGPVLAVIPFDDEEDALSI
ANDINYGLAAGVWTRDIGRAIRLSESLQAGTVWVNTYRAVSFTSPFGGYKRSGLGRESGI
DAMKEYLQVKSVWISTAPDTSNPFVIK
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgacagcacagagcagtgatttgatcagccgtctcgaggatagtgacggcctgacgcag
tacggcctctacatcggtggtgccttcaccgggcccgaggatggcgagtacttcgatact
gtcaatccgtacaccggagaagtctgggcacggatcgccaaaggcggcccggccgacgta
tcccgggccgtcgcttctgcttcggaggctttcaaaagttggagcaggactaagcctcag
caccgcggcaagttgctcatggatctggcagatctaatcgaggccaacagcgaacatctt
gcccggattgaggtccgcgacaacggaaagctctacgcggagatggccgcacagacccgc
tacatggccgggtggtaccgctactacggtggcatggccgacaagatcgagggttcagtc
attcccagtgacaagcccaacatcctcaactacacccggctggagcctctcgggccgatc
gccatgattacgccgtggaactctcccctgcttcttctggcatggaaacttccggcggcg
ctggcggcagggaacacggtggtcatcaaaccctcggaatttacctccgcgtcaacgctg
gagttcatgacactcttcgaaaaggcgggattccctcccggcgtggtcaacacggtcacg
ggattcgggcaggacgtcggggccccgctggtcagtcacccgaatattgtgaaggtggcc
ttcaccggttccgaggcagccgggcagaagatctatgagaatgccgcgagccagttcaag
catgtttcgctcgaattgggcggaaagtccccgaacatcgtctttgaggatgcggatctg
gatgccgctgctgccggtgttatttccggcatcttcgcagcaaccggtcagacgtgcatt
gccggctcgaggctgttggtccagcgctccattcacgacgatttcgtccagcgggtcgtg
gcgctggccgaacaagccaagatcggggaccctatgctgcccgatacgcacgtggggccc
gtgaccacccgtccccagtttgagaaggtgctcgactatatcgacatcgctcggcgcgaa
ggggccacgtgtgtcctgggaggcgccgcttacaccggggagggcgcgtcggggggacag
ttcgtccagccaacgatctttacgaatgttcgcaatgagatgcgcatcgcccaggaagaa
gtctttggtcctgtcctggcggtcatcccgttcgacgacgaagaggacgcactgtccatt
gcgaatgacatcaactacggcctggccgccggagtctggacgcgcgacataggcagggcc
atccgcctttcggaaagcctgcaggccggcacagtatgggtcaacacctaccgtgcggtc
agcttcacatcccccttcggaggatacaagcgcagcggtctgggcagggaaagcgggatt
gacgccatgaaggagtacctccaggtcaagtcagtctggatttctacggctccggatact
tcgaacccgttcgtcatcaagtag

DBGET integrated database retrieval system