KEGG   Arthrobacter sp. PAMC25564: E5206_18080Help
Entry
E5206_18080       CDS       T06052                                 

Gene name
egtC
Definition
(GenBank) ergothioneine biosynthesis protein EgtC
  KO
K07008  gamma-glutamyl hercynylcysteine S-oxide hydrolase [EC:3.5.1.118]
Organism
artp  Arthrobacter sp. PAMC25564
Pathway
artp00340  Histidine metabolism
artp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:artp00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    E5206_18080 (egtC)
Enzymes [BR:artp01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.118  gamma-glutamyl hercynylcysteine S-oxide hydrolase
     E5206_18080 (egtC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_6 GATase_4
Motif
Other DBs
NCBI-ProteinID: QCB98580
UniProt: A0A4P7SVN5
Position
complement(3918534..3919298)
Genome map
AA seq 254 aa AA seqDB search
MCRHLAYIGPPMPLAELLFAPAYGLLTQSWAPRRQRNGTVNADGFGVGWYAPGDPVPARY
RRAIPIWADRSFADVARVTSSRAVLAAVRSATSGMTQEESAAAPYAHGSWLFSHNGRVEG
WPDALEGLAASLPPARLLALEAQVDSALLWALVLERLAAGATPGDALAHVVGTVAAVTGG
RLNFLLTDGTGIAATAAGDTLFWRTGAGSVVVASEPFDDGPGWQEVPDNSLLTATASHVT
IRPIPAHTKEQVAP
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
gtgtgccgtcacctcgcctacatcgggcccccgatgccgctggcggagctgctgttcgct
ccggcgtacgggttgctgacgcagtcctgggcacccaggcggcagcggaacgggaccgta
aacgctgacggtttcggcgtcggatggtatgccccgggggatcccgtacctgcccggtac
cgccgcgcgatcccgatctgggcggacaggtccttcgccgacgtcgccagggttacctcc
agccgggccgtgctcgcggccgtccggtcagcgacatcagggatgacgcaggaggagtca
gctgctgccccttatgcgcacggctcctggctcttcagccacaacgggcgcgtcgaggga
tggccggatgccttggaaggcctggccgcgtcacttccgcccgcccgcctgctggccctt
gaagcccaggtcgactccgcactgctctgggcactcgtgctggaacggctcgccgcaggg
gccacccccggggatgcgctggcgcacgtggtcggcactgtcgctgccgtcaccggcggt
cggctgaacttcctgctcaccgacggcacgggcatcgcggccacggccgccggggacacc
cttttttggcgaaccggcgccgggagcgtcgtggtggccagtgaaccctttgacgacggc
cccggctggcaggaggtgccggacaactcccttctgaccgccaccgccagccacgtcacc
atacgtccgattcccgcccacacgaaggaacaggtggccccatga

DBGET integrated database retrieval system