KEGG   Arthrobacter sp. U41: ASPU41_07435Help
Entry
ASPU41_07435      CDS       T05053                                 

Definition
(GenBank) fuconate dehydratase
  KO
K18334  L-fuconate dehydratase [EC:4.2.1.68]
Organism
aru  Arthrobacter sp. U41
Pathway
aru00051  Fructose and mannose metabolism
aru01100  Metabolic pathways
aru01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:aru00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    ASPU41_07435
Enzymes [BR:aru01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.68  L-fuconate dehydratase
     ASPU41_07435
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MR_MLE_C MR_MLE_N DUF3025 Peptidase_C25_C
Motif
Other DBs
NCBI-ProteinID: AOT03201
UniProt: A0A1C9WPP9
Position
complement(1595922..1597250)
Genome map
AA seq 442 aa AA seqDB search
MSRIISVNTQDVRFPTSLELDGSDAVNVDPDYSAAYVTITADDGESGHGFVFTCGRGNEI
ITAAIESYGRLLIGRDTDELVNDLGAASRRLVHDSQLRWLGPEKGVSHMACGALINALWD
MRAKRERKPLWLLLAEMQPEEIVSAIDFTHIQNALTPADALDILRRGAAGKEARIAELQQ
SGYPAYTTSPGWLGYSDEKLVRLSKEAVADGFGLIKLKVGGSLDEDRRRMRLAREAVGPD
IRIAIDANQRWEVGEAIDWVNALAEYNPWWIEEPTSTDDILGHADIRKGVSPVKVATGEA
VANRIVFKQLLQAGAIDVVQIDSTRVAGVNENLATLLLAARFDTPVCPHAGGVGLCELVQ
HFSFFDYAAVTGTMDNRMIEYVDHLHEHFTEPVRIDGGRYLAPRRPGSGAEMHPASRERW
TFPAGQGWLELGGRAAVTAGVS
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgaatcatctccgtcaacacccaggacgtcaggttccccacctccctggaactg
gacggttccgacgccgtcaacgtggaccccgactactccgccgcctacgtcaccatcacc
gcggacgacggcgaaagcggccacggcttcgtgttcacctgcggccgcggcaatgagatc
atcaccgcggcgatcgaatcctacggccggctgctgatcggccgggacaccgacgaactg
gtcaacgacctcggcgccgcctcccgccgcctggttcacgactcccagctgcgctggctc
ggcccggaaaagggcgtctcccacatggcctgcggtgccctgatcaacgccctctgggac
atgcgcgccaaacgcgaacgcaagcccctgtggctgctcctggccgaaatgcagccggag
gagattgtcagcgcgatcgatttcacccacatccagaacgccctcaccccggccgacgca
ctggacatcctgcgccgcggcgccgccggaaaggaagcccgcatcgccgagctccagcag
agcggctaccccgcctacaccacctcccccggctggctgggctacagcgacgaaaagctg
gtccggctcagcaaggaggccgtggcagacggctttggactcatcaagctcaaggtgggc
ggaagcctcgacgaggaccgccgccgcatgcgtcttgcccgcgaagcagtgggcccggac
atccggatcgccatcgacgccaaccagcgctgggaagtgggagaagccatcgactgggtc
aacgctctggccgagtacaacccctggtggatcgaagaacccaccagcacggacgacatc
ctgggccacgccgacatccgcaagggcgtctcccccgtcaaggtggcaaccggcgaggcc
gtcgccaaccgcatcgtcttcaagcagctcctgcaggccggcgcgatcgatgtcgtccag
attgactccacccgcgtggccggcgtcaacgaaaacctggccaccctgctgctcgctgct
cgcttcgataccccggtctgcccgcacgccggcggcgtgggcctctgcgaactggtgcag
cacttctccttcttcgactacgccgccgtcaccggcaccatggacaaccgcatgatcgaa
tacgtggaccacctccacgagcacttcaccgagccggtaaggatcgacggcggccgctac
ctcgcgccgcgccggcccggttccggcgcggaaatgcacccggcctcccgggagcgctgg
accttccccgccggccagggctggctggaactcggcggccgcgccgctgttaccgcagga
gtgagctga

DBGET integrated database retrieval system