KEGG   Arthrobacter sp. U41: ASPU41_09860Help
Entry
ASPU41_09860      CDS       T05053                                 

Definition
(GenBank) 2,3-butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
aru  Arthrobacter sp. U41
Pathway
aru00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:aru00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    ASPU41_09860
Enzymes [BR:aru01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     ASPU41_09860
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     ASPU41_09860
    1.1.1.-  
     ASPU41_09860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 FAD_binding_3 AdoHcyase_NAD AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: AOT03588
UniProt: A0A1C9WRD4
Position
2133235..2134290
Genome map
AA seq 351 aa AA seqDB search
MKAARFHAREDLRIEDIPEPELRPGAVKIAVAWCGICGTDLHEFLEGPIFTPPPGHPHGL
SHEAAPVTLGHEFSGTVEELGEGVTGLAIGDSVVVEPYIVCNECGPCLSGHYNLCTKLGF
IGLAGGGGGLSETIVVDSRWVHPVGDIPLDEAALIEPLAVAYHAVGRSGVKAGDVAVVGG
AGPIGLLTAAVLKGLGVTTIVTELSTARKDKAVSSGVADHVLDPSSDDVTARVLELTEGA
GANAAFECAGVNAVLDTMFDVVKPAGVVVNVSIWGHPATVDMQKVVLKEIDLRGTIAYCG
DHAAAIKLVQEGKVDLKPFITGRIALDDLVDKGFDTLIHHNDTAVKIIVHP
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagcacgattccatgcccgtgaggacctccggatcgaagacatcccggagccg
gagctgcggcccggagcggtgaaaatcgccgtcgcctggtgcgggatctgcggcacggac
ctccacgaattcctggaagggccgatcttcaccccgccgcccggtcacccccacgggctg
tcccacgaggccgcccccgtcaccctgggacacgagttctccggcaccgtcgaggaactg
ggggagggagtcaccggcctcgccatcggagacagcgtggtggtggagccctatatcgtc
tgcaatgaatgcggtccctgcctcagcggccactacaacctgtgcaccaagctgggcttc
atcggcctggcgggcggcggcgggggcctgagcgagacgatcgtcgtcgactcccggtgg
gtgcaccccgtcggcgatatcccgctggatgaagccgccctcatcgaaccgctggctgtg
gcctatcacgccgtcggccgcagtggcgtcaaagccggggacgtcgccgtcgtcggcggt
gccggccccatcggtttgctgaccgcggcagtcctcaagggccttggcgtcaccacgatc
gtcactgagctgtcgacggcccggaaggacaaagcggtttcctcgggagtcgctgaccat
gttctggacccgagctccgacgacgtcacggcgcgggtgctggaactgacggaaggagcc
ggggcaaacgcggcgttcgaatgcgccggcgtgaatgccgtgctcgatacgatgttcgac
gtcgtcaagccggccggcgtcgtcgtcaacgtctcgatctggggacatccggccaccgtc
gacatgcaaaaggtcgtcctgaaggaaatcgatctgcgcggcaccatcgcctactgcggc
gatcacgcggccgcgatcaagcttgtccaggagggaaaagtcgacctgaagcccttcatc
acgggaagaatcgccctggatgatctcgtggacaagggcttcgatacgctgatccaccac
aacgacaccgcggtgaagatcatcgtccacccctag

DBGET integrated database retrieval system