KEGG   Arthrobacter sp. U41: ASPU41_13345Help
Entry
ASPU41_13345      CDS       T05053                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
aru  Arthrobacter sp. U41
Pathway
aru00020  Citrate cycle (TCA cycle)
aru00310  Lysine degradation
aru00380  Tryptophan metabolism
aru01100  Metabolic pathways
aru01110  Biosynthesis of secondary metabolites
aru01120  Microbial metabolism in diverse environments
aru01130  Biosynthesis of antibiotics
aru01200  Carbon metabolism
Module
aru_M00009  Citrate cycle (TCA cycle, Krebs cycle)
aru_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:aru00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ASPU41_13345
  09105 Amino acid metabolism
   00310 Lysine degradation
    ASPU41_13345
   00380 Tryptophan metabolism
    ASPU41_13345
Enzymes [BR:aru01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     ASPU41_13345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H
Motif
Other DBs
NCBI-ProteinID: AOT04163
UniProt: A0A1C9WSW2
Position
complement(2938021..2939811)
Genome map
AA seq 596 aa AA seqDB search
MSESVNLPALGESVTEGTVTRWLKQVGDRVEVDEPLLEVSTDKVDTEIPSPIAGVIEEIL
VAEDETAEVGAPLVRIGDGSGSAGSAEAPAAEAPAEEAPAEAEAAPAESPSAAEAPAPEA
EAPAAAAPAEAAPAGESHEVTLPALGESVTEGTVTRWLKSIGDTVEVDEPLLEVSTDKVD
TEIPSPVAGTLQEIRVAEDETAEVGSVLAVIGSGAAAPAAAPAPAPAPAPEAPKEAAAPK
EAAPKQEAPKAAAPAEAPKQEAPKQEAPAAPAKEAAPAAEAAPAASSAESGYVTPLVRKL
ANQQGVDISSLSGTGVGGRIRKQDVLAAAEAKAAPAPSAPAPSAAPAARPSADVSSLRGT
VQKAPRIRQVIARRMRESLDISAQLTQVHEVDMTKVAKLRAKAKDSFQAQNGSKLTFLPF
IAKAVAEALKQHPKVNASYDEDKQEITYHNAEHLAIAVDTDKGLLVPVIADAGNLNLAGL
AGKIADVADRTRKGKIGPDELSGGTFSITNIGSVGALFDTPVINQPQVAILGTGAIVKRA
VVVADENGDDSLAIRSMMYLCLTYDHRLVDGADAGRFLQTLKARLEEGAFEADLGL
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaatccgttaacttgcccgccctcggtgagagtgtcaccgaaggaaccgtcacc
cgctggctcaagcaggtaggtgaccgggtagaggtggacgagccgctgctcgaggtttcc
accgacaaagtagacaccgagatcccctctccgatcgccggcgtgattgaggaaatcctc
gtcgccgaagacgagacggctgaagtcggcgcaccgctcgtgcgcatcggcgacggctcc
ggttccgccggctcagccgaagcccctgccgcagaggccccggccgaggaagcgcccgct
gaggctgaagcagcgccggcggaatcgccgtcggccgccgaggcaccggcgccggaagct
gaggcgcccgccgccgcggctcccgcagaagccgctcccgccggcgaaagccatgaggtc
actctcccggccctgggcgagagcgtcaccgaaggcaccgtcacgcgctggctcaagagc
atcggtgacaccgtcgaggtcgacgagccgctgctcgaggtttccaccgacaaggtcgac
accgagatcccgtccccggtggccggcaccctgcaggaaatccgcgttgccgaggacgaa
acggccgaggtcggctccgtcctcgccgtgatcggttccggcgccgcggcccccgccgcg
gccccggccccggccccggccccggccccggaagctccgaaagaagcagcagctccgaag
gaagcagcaccgaagcaggaagctcccaaggctgctgctccggctgaggccccgaagcag
gaggctcccaagcaggaagcacccgctgcccccgccaaggaagctgccccggccgctgag
gctgccccggccgcttcgtccgctgagtccggctacgtcactccgctggtccgcaagctg
gccaaccagcagggcgtggacatcagctccctcagcggcaccggcgtcggtggccggatc
cgcaagcaggacgtgctggcagcagctgaagccaaggcagccccggctccttcggctccc
gcaccgtccgctgctccggccgcgcgcccgtccgctgacgtgtcctcgctgcgcggcacc
gtgcagaaggccccgcggatccgccaggtcattgcccgccggatgcgcgagtcgctggac
atctccgcccagctgacgcaggtgcacgaggtggacatgaccaaggtcgccaagctgcgc
gccaaggccaaggactccttccaggcccagaacggctccaagctgaccttcctgcccttc
atcgccaaggctgtggccgaggccctgaagcagcacccgaaggtcaacgcctcctacgac
gaggacaagcaggagatcacctaccacaacgccgagcacctggcgattgcggtggacacg
gacaagggcctgctggtcccggtcattgccgacgccggcaacctgaacctcgccggcctg
gccggaaagatcgccgacgtcgcggaccggacccgcaagggcaagatcggcccggacgag
ctctccggcggaaccttcagcatcaccaacatcggttccgtgggcgccctgttcgacacg
ccggtcatcaaccagccgcaggttgccatcctcggcaccggggcgatcgtcaagcgcgcc
gttgtggtcgccgatgagaacggcgatgactcgctggccatccgctcgatgatgtacctc
tgcctgacgtacgaccaccggctggtcgacggcgccgacgcgggacgcttcctgcagacg
ctgaaggcccgccttgaggaaggcgctttcgaagccgacctcggactctag

DBGET integrated database retrieval system