KEGG   Aeromonas rivipollensis: C7N77_03035Help
Entry
C7N77_03035       CDS       T05453                                 

Definition
(GenBank) two-component system response regulator OmpR
  KO
K07659  two-component system, OmpR family, phosphate regulon response regulator OmpR
Organism
arv  Aeromonas rivipollensis
Pathway
arv02020  Two-component system
Brite
KEGG Orthology (KO) [BR:arv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    C7N77_03035
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:arv02022]
    C7N77_03035
Two-component system [BR:arv02022]
 OmpR family
  EnvZ-OmpR (osmotic stress response)
   C7N77_03035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C FleQ
Motif
Other DBs
NCBI-ProteinID: AVP92295
UniProt: A0A2P1PBR4
Position
complement(605752..606471)
Genome map
AA seq 239 aa AA seqDB search
MSQQYKVLVVDDDLKLRSLLERYLTEQGFVVRGVANGEQADRLLTRENFSLMVLDLMLPG
EDGLSICRRLREAGNQIPVLMLTAKGDEVDRIVGLEMGADDYLPKPFNPRELLARIRAVL
RRHTVELPGAPSTAEKMVSFGAYQLNLATRELSRDGEPVALTSGEFAVLKVLVSHPREPL
SRDKLMNLARGREYTATERSIDVQVSRLRRLLEQDPAQPRYLQTVWGLGYVFVPDGDGE
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgagtcagcaatacaaggtcctggtggtcgacgacgacctgaaactacgctccctgctg
gagcgttacctcaccgaacagggatttgtggtgcggggcgttgccaatggagagcaggct
gatcgcctgctgacacgcgagaacttcagcctgatggtactcgacctgatgctgccgggg
gaggacgggctctccatctgccgccgcctgcgagaggcgggcaaccagatcccggtgctg
atgctcaccgccaagggggacgaagtggatcgcatcgtcggtctggagatgggggcggat
gactatctgcccaagccgttcaacccccgtgagttgctggcccggatccgcgccgtgttg
cgccgccataccgtcgagctgcccggcgccccctccaccgccgagaagatggtgagcttt
ggcgcctatcaactcaacctggcgacccgcgagctgagccgtgacggggagccggtggcc
ctgaccagcggcgagtttgccgtcctcaaggtgttagtgagccaccctcgcgagccgctc
tcccgggataagctgatgaacctggcccggggccgggaatacacagccacagagcgcagc
atagatgtgcaggtctcccgtctgcgccgcctgctggagcaggatccggcccagccccgt
tacctgcagacagtgtggggcctgggctatgtcttcgtgccggacggtgacggggaatga

DBGET integrated database retrieval system