KEGG   Arthrobacter alpinus A3: MB46_01700Help
Entry
MB46_01700        CDS       T04228                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
arw  Arthrobacter alpinus A3
Pathway
arw00020  Citrate cycle (TCA cycle)
arw00480  Glutathione metabolism
arw01100  Metabolic pathways
arw01110  Biosynthesis of secondary metabolites
arw01120  Microbial metabolism in diverse environments
arw01130  Biosynthesis of antibiotics
arw01200  Carbon metabolism
arw01210  2-Oxocarboxylic acid metabolism
arw01230  Biosynthesis of amino acids
Module
arw_M00009  Citrate cycle (TCA cycle, Krebs cycle)
arw_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:arw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MB46_01700
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    MB46_01700
Enzymes [BR:arw01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     MB46_01700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH
Motif
Other DBs
NCBI-ProteinID: ALV44426
UniProt: A0A0U3QGQ1
Position
394526..396748
Genome map
AA seq 740 aa AA seqDB search
MAKIIYTLTDEAPMLATYSLLPIVEAFASTAGVDVETRDISLSGRIISAFSDFLTEEQRT
ADALTELGALAKSPDANIIKLPNISASIPQLKAAVAELQSQGFALPSYPDDPSTDEEKDI
RARYDKIKGSAVNPVLREGNSDRRAPLSVKNYAKANPHSMGAWSADSKTNVATMDDGDFR
HNEKSVFIEADDKIKIQFVAEDGTVTVLKDSFPVLADEIVDGTVMRAAALDEFLAAQVAR
AKEEGILLSAHLKATMMKVSDPIIFGHVVKAYFPELFANYGEALAAAGLSPANGLASILN
GLGNLPADVREGVEAAIKSGYENGPALAMVDSDKGITNLHVPSDVIVDASMPAMIRTSGH
MWGADGAEADTLAVLPDSSYAGVYQATIDDCRANGAFDPTTMGTVPNVGLMAQAAEEYGS
HDKTFELAEAGTVQIVNGAGVVLIQHDVEAGDIWRACQVKDIPVRDWVKLAVTRARASAT
PAIFWLDETRAHDANLITKVNEYLKDHDTEGLDIRIMSPEKATTFTLDRIRRGEDTISVT
GNVLRDYLTDLFPILELGTSAKMLSIVPLIAGGGLFETGAGGSAPKHVQQLIKENHLRWD
SLGEFLAIAVSFEHLAVTEGNARAQILADTLDRATGTFLLEDKSPKRKVGEIDNRGSHFH
LAKFWAQELAAQTADAELAAAFAAVADALASNEDVIINELAIVQGSPVDLGGYYRPDAAK
VADIMRPSATLNKAIAALAK
NT seq 2223 nt NT seq  +upstreamnt  +downstreamnt
atggccaagattatttacaccctgacagacgaagcgcccatgttggccacgtactccctc
ctgccgattgttgaggccttcgcctccaccgccggtgtggacgtagaaaccagggacatc
tccctgtccggccgcatcatctccgcatttagcgacttcctcaccgaagagcagcgcacc
gcggacgccctgaccgagctgggcgccctggccaagagcccggatgccaacatcatcaag
ctccccaacatcagcgcttccatcccgcagctgaaggcggccgtcgccgaactccagagc
cagggcttcgccctcccgagttacccggacgacccctccaccgacgaggaaaaggacatc
cgcgcccgctacgacaagatcaagggcagtgccgtgaacccggtcctgcgcgaaggcaac
tccgaccgccgcgcacccctgtcggtcaagaactacgcgaaggccaacccgcacagcatg
ggcgcctggtccgctgactccaagaccaacgtcgccaccatggacgacggcgacttccgc
cacaacgagaagtccgtattcatcgaagccgatgacaaaatcaagatccagttcgtcgcc
gaagatggcacggtcactgtattgaaggattccttcccggtcctggccgacgaaattgtt
gacggcaccgtcatgcgcgcagcagcactggacgagttcctagctgcccaggttgcccgc
gccaaggaagagggcatcctcctctcggcacacctgaaggccaccatgatgaaggtctcc
gaccccatcatcttcggccatgtggtcaaggcctacttcccggaactgttcgccaactac
ggcgaggcacttgccgcagcaggcctgagcccggccaacggcctggcctccatcctcaac
ggtctgggcaacttgccggcagacgtccgcgagggcgttgaagccgccatcaagagcggc
tacgaaaacggtccggcactggccatggtcgattccgacaagggcatcaccaaccttcac
gtcccttccgacgtgattgttgatgcctccatgcccgccatgatccgcacctccggccac
atgtggggcgcggatggcgcagaggccgacaccctggccgtgctgcccgacagcagctac
gccggcgtctaccaggccacgatcgatgactgccgcgcaaacggcgccttcgaccccacc
accatgggcaccgtccccaacgtgggcctcatggcacaggcagccgaggaatacggcagc
cacgacaagaccttcgagctggccgaggccggcaccgtgcagatcgtcaacggcgctggc
gttgtcctgatccagcacgacgtcgaagccggcgacatctggcgcgcctgccaggtcaag
gacatcccggtccgcgactgggtcaagcttgccgtcacccgtgcccgcgcctccgccacc
cccgccatcttctggctggacgagacccgcgcacacgacgccaacctcatcaccaaggtc
aacgagtacctcaaggaccacgacaccgagggcctggatatccggatcatgtccccggag
aaggccacaaccttcaccctggaccgtatccgccgcggcgaggacaccatctccgtcacc
ggtaacgtgctccgcgactacctcacggacctgttcccgatcctggaactgggcaccagc
gccaagatgctctccatcgtgccgctgatcgcaggcggtggccttttcgagaccggtgcc
ggtggatccgccccgaagcacgtccagcagctcatcaaggaaaaccacctccgctgggat
tccctgggcgagttcctggcgatcgccgtgagcttcgaacacctggccgtcaccgagggc
aacgcccgcgcacagatcctggccgacaccctggaccgcgcaacgggaacgttcctgctc
gaggacaagtccccgaagcgcaaggtcggcgagatcgacaaccgtggcagccacttccac
ctggccaagttctgggcccaggaattggccgcgcaaacggccgacgccgagctggccgct
gctttcgctgctgtcgctgatgccttggccagcaacgaagatgtcatcatcaacgagctg
gccattgtgcagggctcgccggttgacctgggcggttactaccggcccgacgccgccaag
gttgcagacatcatgcgcccctcggcaacgctgaacaaggccatcgcagcactcgccaaa
tag

DBGET integrated database retrieval system