KEGG   Arthrobacter alpinus A3: MB46_02205Help
Entry
MB46_02205        CDS       T04228                                 

Definition
(GenBank) fructose 1,6-bisphosphatase
  KO
K02446  fructose-1,6-bisphosphatase II [EC:3.1.3.11]
Organism
arw  Arthrobacter alpinus A3
Pathway
arw00010  Glycolysis / Gluconeogenesis
arw00030  Pentose phosphate pathway
arw00051  Fructose and mannose metabolism
arw00680  Methane metabolism
arw01100  Metabolic pathways
arw01110  Biosynthesis of secondary metabolites
arw01120  Microbial metabolism in diverse environments
arw01130  Biosynthesis of antibiotics
arw01200  Carbon metabolism
Module
arw_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:arw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MB46_02205
   00030 Pentose phosphate pathway
    MB46_02205
   00051 Fructose and mannose metabolism
    MB46_02205
  09102 Energy metabolism
   00680 Methane metabolism
    MB46_02205
Enzymes [BR:arw01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     MB46_02205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_glpX
Motif
Other DBs
NCBI-ProteinID: ALV44506
UniProt: A0A0U3QGX6
Position
506297..507334
Genome map
AA seq 345 aa AA seqDB search
MAQKASQLDYSQLSRSLAVGDDEPDRNLALELVRVTEAAAIAGGHWVGFGEKNLADGAAV
DAMRSLLSTVHFNGVVVIGEGEKDEAPMLFNGEVVGDGSGPECDVAVDPIDGTRLTAMGI
NNALSVLAVAERGTMFDPSAVFYMEKLVTGPEAADMVDLRLPVKQNLHLIAKAKGVKINQ
LTVMVLDRDRHQPLIAEIREAGARTKIILDGDVAGAIAAARSGTGVDALMGIGGTPEGIV
AACAIKTLGGVIQGRLWPTSDEEKQKAIDAGHDLDRVLSTNDLVTSDNCYFAATGITDGD
LLRGVRYDKGRVLTQSIVMRSKSGTIRFVDGEHQAHKWESYARRS
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
gtggctcaaaaagcatcgcagttggattattcacagttgtcccggtctctcgctgttggc
gatgacgaaccggaccggaatctagcccttgaacttgtccgcgtgaccgaagctgccgct
attgccggcggccactgggttggttttggtgagaagaacctagccgacggcgcagccgtt
gacgctatgcgttctctcctgtctacagtgcacttcaacggtgttgtggtcattggtgag
ggcgaaaaagatgaagcccccatgctgttcaatggcgaggtagtgggcgacggctccgga
cctgagtgtgacgtagccgtggatcccatcgatggaacccgtctgacggccatgggcatc
aacaacgccctgtccgtgctggctgtggctgaacgcggcaccatgtttgacccctccgcc
gtgttctacatggaaaagctggtcaccggccccgaagccgccgacatggttgacctgcgc
ctgcctgtcaagcagaacctgcacctgatcgccaaggccaagggcgtaaagatcaaccag
ctcacggtcatggttctcgatcgcgatcgccaccagccgcttattgctgaaatccgcgaa
gctggcgcccgtaccaagatcatcctcgacggcgacgttgccggcgctatcgcagccgca
cgttccggcaccggcgttgacgcgctcatgggcatcggtggcacacccgaaggcatcgtt
gcggcatgtgccatcaagaccctgggtggcgtcatccagggccgtctgtggcccacctcc
gatgaagagaagcagaaggcgatcgacgccggacacgatctggaccgcgtgctgtccacc
aacgatctggtcacaagcgacaactgctacttcgccgccaccggcatcaccgatggcgat
ctcctccgcggcgtgcgctacgacaagggccgcgtgctcacacagtccatcgttatgcgc
tccaagtccggcaccatccgtttcgtcgatggcgagcaccaggcacacaagtgggagtcc
tacgcccgccgcagctag

DBGET integrated database retrieval system