KEGG   Arthrobacter alpinus A3: MB46_02600Help
Entry
MB46_02600        CDS       T04228                                 

Definition
(GenBank) mannose-1-phosphate guanylyltransferase
  KO
K00971  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
arw  Arthrobacter alpinus A3
Pathway
arw00051  Fructose and mannose metabolism
arw00520  Amino sugar and nucleotide sugar metabolism
arw01100  Metabolic pathways
arw01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:arw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    MB46_02600
   00520 Amino sugar and nucleotide sugar metabolism
    MB46_02600
Enzymes [BR:arw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     MB46_02600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 MannoseP_isomer TrbC
Motif
Other DBs
NCBI-ProteinID: ALV44571
UniProt: A0A0U3QSR4
Position
complement(609620..610765)
Genome map
AA seq 381 aa AA seqDB search
MTTQIFGDMAVPTLDPLNRFYAVIPAGGVGTRLWPLSRAAAPKFLHDLTGSGSTLIRATY
DRLEPLSGERVLLVTGDAHREAVCRQLPEIADANLVLETEPKDSGAAIGLAAAILFVRDP
SAIMGSFAADQVISPVEKFQDAVREAIYTAATGKIVTIGIKPTHASTGFGYIRIGAPLSV
AGAPRAHAVAKFVEKPSQEIAEEYLASGEYSWNAGMFVAPVDLMLHHLKANEPALYEGLM
EIALAWDTPERVEVKNRVWPTLPKIAIDYAVAEPAADAGDVAVIPADFSWDDVGDFAAIA
RLSSAKESKNVKVIGDGARVFTEDSTGIVVSDTKRVIALVGIQDVVVVDTPDALLITTLA
HSQLVKKAVDGLKAQGNTDVL
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgaccacccaaattttcggcgacatggctgtgcccacattggatcccttgaataggttt
tatgctgtgatcccggctggtggggttggtactcggttgtggccgttgtctcgtgctgct
gctccgaagtttctccatgacctcaccgggagcggtagtaccttgatccgggctacctat
gaccgtttggagccccttagtggtgagcgggttctgttggtgacgggggatgcgcatcgt
gaggctgtgtgccggcagttgccggagatcgctgacgcgaatctggtgttggaaactgag
ccgaaggattccggtgcggctattgggttggctgcggcgatcttgtttgttcgtgatccc
tccgcgattatgggttctttcgcggctgatcaggtcatcagtcccgtggagaagttccag
gatgctgtgcgtgaggccatctataccgcggccacgggcaagatcgttacgatcggtatc
aagccaacccatgcctcgaccggattcgggtatatccgcatcggtgcaccgctttcggtg
gcgggtgcgccgcgggctcatgctgtggcgaagttcgtcgagaagcccagtcaggagatc
gccgaggagtacctggccagtggtgaatacagttggaatgctggaatgttcgtggccccg
gtggatttgatgctccatcacctcaaggccaacgagcctgccctgtatgaagggttgatg
gaaatcgccttggcctgggacaccccggagcgggttgaagtgaagaaccgggtctggcct
accctgcccaagatcgccattgattatgcggtggccgagccggccgcggatgcgggggac
gttgccgtgattcctgctgactttagctgggatgatgtgggagatttcgcggcgatcgcc
cggctcagcagtgctaaggaaagtaagaacgtgaaggtcataggggacggtgcccgtgtc
ttcaccgaagacagcaccgggatcgtggtctcggacaccaaacgcgtgatcgccctagtt
gggatccaagacgtggtggtggttgatacccccgacgcccttcttatcacgaccctcgca
cattcacagctggtcaagaaagccgtcgacggactcaaagcccaaggcaacaccgacgtc
ctctaa

DBGET integrated database retrieval system