KEGG   Arthrobacter sp. ZXY-2: ARZXY2_2011Help
Entry
ARZXY2_2011       CDS       T05201                                 

Gene name
ltaE
Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
arx  Arthrobacter sp. ZXY-2
Pathway
arx00260  Glycine, serine and threonine metabolism
arx01100  Metabolic pathways
arx01110  Biosynthesis of secondary metabolites
arx01120  Microbial metabolism in diverse environments
arx01130  Biosynthesis of antibiotics
arx01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:arx00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ARZXY2_2011 (ltaE)
Enzymes [BR:arx01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     ARZXY2_2011 (ltaE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AOY71555
UniProt: A0A1D9F885
Position
2093425..2094519
Genome map
AA seq 364 aa AA seqDB search
MIPVGSPYPIRIDLFSDTITRPSGAMRQAMAHAEVGDEQKGEDPSTNELVALARELLGKE
EAVFLPSGTMCNQISYALHCRPGDAILVDDNAHSLRHEETGAPALAGALFRPIKADRGVF
SADQLTAALGPEGRSMARNAVLSIEQPSNLGGGTCWSLEGITSVTAVARAHQIKTHMDGA
RLLNAVVATGVSARDFCAPFDSVWLDLSKGLGAPLGAVLAGDADFISEAWRLKQRWGGSM
RQSGIVAAAGTFALRNNVDRLADDHANARLLAELLTGHRNISIDPTTVQTNIVLFDLVDC
PVTAPVLVERLLRKCGVRMGAFGPSTIRAVTHLDVDTAGVRLAAEALRELLDDIYSLHSS
KRSC
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
gtgattcccgtcgggtccccctacccgatccgcatcgaccttttcagcgacacgattacc
cggccttcaggggccatgcggcaggccatggcccacgccgaggtgggggatgaacaaaag
ggtgaagacccctccaccaacgaactcgttgccctggcccgggaactgctgggcaaggaa
gaagcggtcttcctgccatcagggaccatgtgcaaccagatctcctacgccctgcactgc
cgcccgggcgatgcgatccttgttgacgacaacgcgcactcgctccgccacgaggaaacc
ggggcaccagccttggccggagccttgttcaggcccatcaaagccgatcgtggtgttttc
tccgctgaccagctcacagcggccctcgggcccgagggccggtcgatggcccggaatgcg
gtgctctccattgagcagccttccaacctcggcggcggcacatgctggtccctggagggc
atcacctccgtgaccgcggtagcacgggcgcatcagatcaagacccacatggacggcgcc
cgcctgctcaatgcggtagtagccacaggagtgtccgcccgcgatttctgtgccccgttc
gactcagtctggctggatctcagcaagggactgggtgcccccctgggagcagtgctggca
ggagacgcggatttcatcagcgaagcctggcgcctgaaacaacggtggggtggctccatg
cgccagtccggcatcgtggctgcggccggcacctttgccctccgcaacaacgtggacaga
ctggccgacgaccacgccaacgcccgcctcctggctgagctgctgaccggccaccgcaac
atctcgatcgaccccacgacggttcagaccaacattgtcctctttgacctggtggactgc
ccagtcactgcaccggttctggtggagcgcctgctccggaagtgcggggttcgaatgggc
gcttttggcccgtccacgatccgtgccgtcacccacctcgatgtggacacggcaggcgta
cgcctcgctgcagaggccctccgcgaattgctggacgacatctactcgctgcactcaagc
aaaaggagttgctga

DBGET integrated database retrieval system