KEGG   Arthrobacter sp. ZXY-2: ARZXY2_3859Help
Entry
ARZXY2_3859       CDS       T05201                                 

Definition
(GenBank) MdlA
  KO
K20023  L-talarate/galactarate dehydratase [EC:4.2.1.156 4.2.1.42]
Organism
arx  Arthrobacter sp. ZXY-2
Pathway
arx00053  Ascorbate and aldarate metabolism
arx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:arx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    ARZXY2_3859
Enzymes [BR:arx01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.42  galactarate dehydratase
     ARZXY2_3859
    4.2.1.156  L-talarate dehydratase
     ARZXY2_3859
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MR_MLE_C MR_MLE_N
Motif
Other DBs
NCBI-ProteinID: AOY73363
UniProt: A0A1D9FDJ1
Position
4008999..4010126
Genome map
AA seq 375 aa AA seqDB search
MSPVDLVRHVKLSTARLPLTVPISDAKVFTGRQKPMTEVVFLFAEITTEQGHSGLGFSYS
KRAGGPAQYAHAKEVAQGLIGEDPNDIGKIYAKLLWAGASVGRSGVATQALAAIDIALYD
LKAKRAGLPLAKLLGSYRDSVRTYNTSGGFLNATLDEVKARATQSIEEGIGGIKIKVGLP
DSKEDLRRVAGVREHIGQELPLMVDANQQWDRATALRMGRQLEEFNLIWIEEPLDAYDFE
GHAHLAQVLDTPIATGEMLASVAEHKGLINANGCDIIQPDAPRVGGITQFLRLATLADER
GLGLAPHFAMEIHLHLAAAYPTEPWVEHFDWLDPLFEERLETKDGRMIVPDRPGLGVTLS
GQARAWTTESVEFGA
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgagccccgtcgaccttgtccgccacgtcaaactatccactgcacggctacccctcacg
gtgcccatcagtgacgccaaggtcttcacaggccggcaaaagcccatgaccgaggtggtc
ttcctcttcgccgaaatcaccacggaacagggccatagtggcctgggcttcagctattcg
aagcgggccggcggccccgcgcagtacgcccacgccaaggaagttgcccaaggcctgatc
ggcgaggacccgaacgacatcggcaaaatctacgccaagctcctctgggccggcgcatcg
gtgggccgttccggcgtcgccacccaagcgcttgccgccatcgatattgcgctgtacgac
ctcaaagccaaacgtgccggcctccccctggccaagctcctcggctcctaccgcgattcc
gtccggacctacaacacatcaggcggcttcctgaacgccacgttggacgaggtcaaagcc
cgcgccacccagtccatcgaggaaggcatcggcggcatcaagatcaaggtcggcctgccc
gactccaaggaagacctccgcagggtggccggcgtccgcgaacacatcggccaagagctt
ccactcatggtggatgccaaccaacagtgggacagggccaccgccctgcgcatgggccgc
caactggaggaattcaacctcatctggatcgaagaacccctggacgcgtacgacttcgag
ggccacgcccaccttgcccaggtcctggacacgcccatcgccaccggcgaaatgcttgcc
tcggtggccgagcacaagggcctcatcaacgccaacggctgcgacatcatccaaccggac
gcaccgcgcgtcggcggcatcacgcagttcctgcgcctggcaaccctcgcggatgagcgc
ggcctgggcctggcgccgcacttcgcaatggaaatccacctccacctcgcagccgcctat
cccaccgagccgtgggtggagcacttcgactggctcgatccgctcttcgaggaacggctg
gagacgaaggacggccgcatgatcgtcccggatcgccccggcctgggcgtgacactcagc
gggcaggcacgggcctggaccaccgagtccgtggagttcggcgcgtaa

DBGET integrated database retrieval system