KEGG   Arthrobacter sp. YC-RL1: ATC04_01185Help
Entry
ATC04_01185       CDS       T04187                                 

Definition
(GenBank) malate synthase
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
ary  Arthrobacter sp. YC-RL1
Pathway
ary00620  Pyruvate metabolism
ary00630  Glyoxylate and dicarboxylate metabolism
ary01100  Metabolic pathways
ary01110  Biosynthesis of secondary metabolites
ary01120  Microbial metabolism in diverse environments
ary01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ary00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ATC04_01185
   00630 Glyoxylate and dicarboxylate metabolism
    ATC04_01185
Enzymes [BR:ary01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     ATC04_01185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase FliE
Motif
Other DBs
NCBI-ProteinID: ALQ29290
UniProt: A0A0H0ZXA2
Position
255868..257499
Genome map
AA seq 543 aa AA seqDB search
MSISLSRIPEFDGAADILSDDALAFIEKLHQKFAGTRNELLAARDVRRKQFSDAKAIDFD
PATEEVRNGDWKVAEAPAALQDRRVEITGPATPAKMAINALNSGAKVWLADLEDASTPSW
NNVIDAVKNLSDAARGKLAFTDEKTGKSYALRTDAPLATVVVRPRGWHLPENNVLIDGKP
GVGALVDFGLHFFHNAKVLAESGQGPFYYLPKMEHYLEVRLWNEVFTFAQAELGIEYGTV
RATMLIETIPAAFQMDEFLYELRDHVSGLNAGRWDYLFSIIKTFREAGDAFIMPDRADVS
MTAPMMRAYTELLVKTCHKRGAFAMGGMAAFIPNRREPEVTAAAFEKVRADKTREANDGF
DGSWVAHPDLVGTCMEVFDSVLGSKPNQLDKQRPEVEVTAEQLLDIASAPGSVTEAGVRL
NLYVAVAYTAVWLSGNGAVAIHNLMEDAATAEISRSQIWQQIRNKVVAADTGNTITAELV
ASILDEEVEKLRGEVNDAERFAKYYEPAATLIGTLVSGRDEDFADFLTTGAYELLEKEYV
TKP
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atgagcatttcactatcccgcattccggagttcgacggcgcggcagacatcctctcggat
gacgcgctggcattcatcgagaagctgcaccagaagttcgccggaacccgcaacgagctg
ctggccgcccgcgacgtgcgccgcaagcagttctccgatgccaaggccatcgacttcgac
ccggccaccgaagaggtccgcaacggcgactggaaggtcgccgaggcgcctgcagcgctg
caggaccgccgcgtggagatcaccggcccggccacccccgccaagatggcaatcaacgca
ctgaactccggcgccaaggtgtggctggcggacctcgaggacgcctccaccccgagctgg
aacaacgttatcgacgcggtgaagaacctgtcggacgccgcccgcggcaagctggccttc
accgatgagaagaccggaaagtcctacgcactgcgcaccgatgcgccgctggccaccgtg
gtggtccgcccgcgcggctggcacctgccggagaacaacgtgctgatcgatggcaagccg
ggcgtcggcgcgctggtcgacttcggcctgcacttcttccacaacgcgaaggtgctcgcc
gaatccggccagggaccgttctactacctgccgaagatggagcactacctggaggtgcgc
ctgtggaacgaggtcttcaccttcgcgcaggccgaactgggcatcgagtacggcacggtg
cgcgccaccatgctcatcgagaccatccctgccgccttccagatggacgagttcctctac
gagctgcgcgaccacgtttcgggcctgaacgccgggcgctgggactacctgttctccatc
atcaagaccttccgcgaagccggcgacgcgttcatcatgcccgaccgcgcggatgtctcg
atgaccgcgccgatgatgcgcgcctacaccgaactgctggtcaagacctgccacaagcgc
ggcgccttcgccatgggcggcatggcggccttcatcccgaaccgccgcgaacctgaagtc
accgccgcggccttcgagaaggtgcgcgcggacaagacccgcgaagcgaacgacggcttc
gacggctcctgggttgcccacccggacctggtcggcacctgcatggaggtcttcgactcc
gtgctggggagcaagccgaaccagctggacaagcagcgtccggaggtcgaggtcaccgcg
gagcagctgctggacatcgccagcgccccgggctcggtcaccgaggccggcgtgcgcctg
aacctctacgtggcagtggcctacaccgccgtgtggctctcgggcaacggcgccgtggca
atccacaacctgatggaggacgccgccaccgcggaaatctcccgctcgcagatctggcag
cagatccgcaacaaggtcgtggccgccgacaccggcaacaccatcaccgccgaactggtg
gcaagcatcctggacgaagaggtagagaagctgcgcggggaggtcaacgacgccgagcgc
ttcgcgaagtactacgagccggccgccacgctgatcggcaccctggtctccggacgcgac
gaggacttcgcagacttcctcaccaccggcgcctacgaactactggaaaaggaatacgtg
accaagccatga

DBGET integrated database retrieval system