KEGG   Arthrobacter sp. YC-RL1: ATC04_02175Help
Entry
ATC04_02175       CDS       T04187                                 

Definition
(GenBank) formate--tetrahydrofolate ligase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
ary  Arthrobacter sp. YC-RL1
Pathway
ary00670  One carbon pool by folate
ary01100  Metabolic pathways
ary01120  Microbial metabolism in diverse environments
ary01200  Carbon metabolism
Module
ary_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:ary00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    ATC04_02175
Enzymes [BR:ary01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     ATC04_02175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTHFS CbiA
Motif
Other DBs
NCBI-ProteinID: ALQ29460
UniProt: A0A0H0ZRD0
Position
475080..476765
Genome map
AA seq 561 aa AA seqDB search
MSGTTEIDMSDLAIASRAVLKPISQIAEAAGIPEEAVESYGRYKAKIDPSHLPARSAELG
KVVLVSGISPTPAGEGKSTVVVGLGDALSAAGAKTLIALREPSLGPIFGMKGGATGGGYS
QVLPMDEINMHFTGDFHAITSANNLLMALIDNHLHRGNALGIDPRRITFKRVIDMNDRAL
RNIVIGLGGPTEGVPREAGFEITVASEVMAVFCLATGLEDLRTRLGRMTIGYTYEKKPVT
VDDLGAAGAMTMLLKDAIKPNLVQTIGGTPAFIHGGPFANIAHGCNSAIATNTARSLADV
VVTEAGFGADLGAEKFMDIKARYAGCEPSAVVIVATIRALKMHGGVAKDQLKGENVQAVR
DGMVNLARHASNVRKFGIHPVIAVNKFTDDTVDELAVVTEWAAENNIECAVADVWGQGGA
GAGDLAAAVLRAIEAPSDFAPLYELEKPVEEKILTVVKEIYGGAEVDYTPAAKRVLEQIH
ANGWDNLPVCMAKTQYSFSDDPTLLGAPEGFTLLVRDLIPKTGAGFIVAITGAIMTMPGL
PKVPAAMHMDVDENGNAVGLS
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atgtcagggacgacggaaatcgatatgagcgatctcgcgattgcctcacgcgcggtgctc
aagccaatttcgcagatcgccgaagccgcggggatcccggaagaagcagtcgagtcctat
ggcaggtacaaggccaagatcgacccgtcgcatcttcctgcccgcagcgccgagctcggc
aaggtggtgctggtcagcggaatttccccgactcccgccggtgaagggaaatccaccgtc
gtggtgggcttaggtgatgcgttgtccgccgccggagccaagacgctcattgcactgcgc
gaaccttccctggggccgatcttcggcatgaagggcggggccaccggcggcgggtattcg
caggtgctgccgatggacgagatcaacatgcacttcaccggcgacttccatgcgatcacc
agcgccaacaacctgctgatggcactgatcgacaaccacctgcaccgcggcaatgccctg
gggatcgacccgcggcggatcaccttcaagcgcgtcatcgacatgaacgaccgcgccctg
cgcaatatcgtcatcggcctgggcggcccgaccgagggcgttccgcgcgaggcaggtttc
gagatcaccgtggcctcggaggtcatggcggtgttctgcctggccaccgggctggaagac
ctgcgcacccggctgggacgcatgaccatcgggtacacctatgagaagaagccggtgacc
gtggacgacctgggcgcggccggcgccatgacgatgctgctcaaggacgccatcaagccg
aacctggtgcagaccatcggcggcaccccggcgttcatccacggcgggccgttcgccaat
atcgcccacggctgtaactcggccatcgccaccaacaccgcccgctcgctggccgatgtc
gtggtcaccgaagcagggttcggcgcggacctgggcgcggagaaattcatggacatcaag
gcccgctacgccgggtgcgagccatccgccgtggtgatcgtggcgaccatccgcgccttg
aaaatgcacgggggagtagccaaagaccagcttaagggcgagaacgtgcaggcggtgcgc
gacggcatggtgaacctggcccggcacgcctccaacgtcaggaagttcgggatccatccg
gtcatcgccgtcaacaagttcaccgacgacaccgtggacgagctggctgtggtcaccgag
tgggccgcggaaaacaacattgaatgtgccgtggcggatgtctggggccaaggcggcgcc
ggagccggggacctggccgcggcggtgctgcgcgccatcgaagcaccgagcgacttcgcc
ccgctgtatgagttggagaagccggtggaggagaagatcctcaccgtggtgaaggagatc
tacggaggggcggaagtggactacactcccgctgcgaagcgggtgctggaacagatccat
gccaacggctgggacaacctgccggtgtgcatggccaagacgcaatactccttctcggat
gaccctacgctgctgggcgcgcccgagggcttcacgctgctggtgcgcgacctcattccg
aagaccggggccggtttcattgtggcgatcaccggcgcaatcatgaccatgcccggcctg
cctaaggtgcccgccgcgatgcacatggacgtggacgagaacggaaacgcggtcggcctg
tcctaa

DBGET integrated database retrieval system