KEGG   Arthrobacter sp. YC-RL1: ATC04_14860Help
Entry
ATC04_14860       CDS       T04187                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
ary  Arthrobacter sp. YC-RL1
Pathway
ary00020  Citrate cycle (TCA cycle)
ary00480  Glutathione metabolism
ary01100  Metabolic pathways
ary01110  Biosynthesis of secondary metabolites
ary01120  Microbial metabolism in diverse environments
ary01130  Biosynthesis of antibiotics
ary01200  Carbon metabolism
ary01210  2-Oxocarboxylic acid metabolism
ary01230  Biosynthesis of amino acids
Module
ary_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ary_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:ary00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ATC04_14860
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    ATC04_14860
Enzymes [BR:ary01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     ATC04_14860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH IFN-gamma
Motif
Other DBs
NCBI-ProteinID: ALQ31702
UniProt: A0A0H0ZST8
Position
complement(3221552..3223786)
Genome map
AA seq 744 aa AA seqDB search
MAKIIYTHTDEAPMLATHSFLPIVEAFASTAGVELETRDISLAGRIIATFPDYITEEQRI
GDALAELGDLAKTPEANIIKLPNISASIPQLKAAIAELQAAGYALPDYPDNPSSDEETDV
RARYDKIKGSAVNPVLREGNSDRRAPLSVKNYARKYPHSMGAWAADSKTNVATMGVDDFA
SNEKSIVIDKDKSISIRFVGEDGEVKVLKKPFKVLKGEVIDGTVMHVAALQDFLKASVAR
AKEEGILFSAHLKATMMKVSDPIIFGQVVKAYFSELFDTYGDELAAAGLNPNNGLAAILN
GLDELSDDVRAGVEKLIAKGLEEGPAVAMVDSDKGITNLHVPSDVIVDASMPAMIRLGGK
MWDAKGETADTLAVLPDSSYAGVYQAVIEDCRANGAYDPTTMGTVPNVGLMAQKAEEYGS
HDKTFELAANGHVQIVDENDTVLIEHQVFTGDIWRACQTKDVAIRDWVKLAVNRARASQT
PIVFWLDENRAHDAVLIAKVNEYLKEHDTEGLTIEILSPIEATKYSIERIRKGEDTISVT
GNVLRDYLTDLFPILELGTSAKMLSIVPLLAGGGLFETGAGGSAPKHVQQLVSENHLRWD
SLGEFMALGASFEHLAVTTGNARAQVLADTLDAATGTFLLEDKSPKRKVGELDNRGSHFY
LAKFWAEELAKQDKDAELASAFADVAKALGENEETIVAELAEVQGKPVDLAGYYRPSEEK
TSAVMRPSATLNKALELLTNAVSK
NT seq 2235 nt NT seq  +upstreamnt  +downstreamnt
atggccaagattatttacacccacaccgacgaagcgccgatgctggcgacccactcgttc
ctgccgatcgtggaggccttcgcctcgaccgccggtgtggagctggagacccgcgacatc
tcgctggccggccgcatcatcgccaccttcccggactacatcaccgaagagcagcgcatc
ggcgacgccctggctgagcttggcgacctggccaagaccccggaagctaacatcatcaag
cttccgaacatctccgcgtcgatcccgcagctgaaggccgcgatcgccgagctgcaggcc
gccggctacgccctgccggactacccggacaacccttcctccgacgaagagaccgacgtc
cgcgcccgctacgacaagatcaagggctccgccgtgaacccggtgctgcgcgagggcaac
tccgaccgccgcgcaccgctgagcgtgaagaactacgcccgcaagtacccgcactcgatg
ggcgcctgggccgcggactcgaagaccaacgtcgccaccatgggcgttgacgacttcgcc
tcgaacgagaagtccatcgtcatcgacaaggacaagtcgatctccatccgcttcgtcggc
gaagacggcgaagtcaaggtcctgaagaagcctttcaaggtgctcaagggcgaggtcatc
gacggcaccgtcatgcacgtggcagccctgcaggacttcctgaaggcctccgtggcccgc
gccaaggaagagggcatcctcttctcggcacacctgaaggccaccatgatgaaggtctcc
gacccgatcatcttcggccaggtcgtcaaggcctacttctccgagctgttcgacacctac
ggggacgagctggcggcagccggcctgaacccgaacaacggcctggccgccatcctcaac
ggcctggacgagctctccgacgacgtgcgcgccggcgttgagaagctgatcgccaagggc
ctggaagagggcccggcagttgccatggtcgactccgacaagggcatcaccaacctgcac
gtcccatcggacgtcatcgtggacgcttccatgcctgccatgatccgcctgggcggcaag
atgtgggacgccaagggcgagaccgcagacaccctggccgtgctgcccgactcctcctac
gcaggcgtctaccaggccgtgatcgaggactgccgtgccaacggcgcctacgacccgacc
accatgggcaccgtgccgaacgtcggcctgatggcccagaaggccgaggaatacggctcc
cacgacaagaccttcgagctggccgccaacggacatgtgcagatcgtcgacgagaacgac
accgtgctgatcgagcaccaggtcttcaccggagacatctggcgcgcctgccagaccaag
gacgtcgccatccgcgactgggtgaagctggcagtgaaccgcgcccgcgcctcccagacc
ccgatcgtgttctggctggatgagaaccgcgcccacgacgccgtgctgatcgccaaggtc
aacgagtacctcaaggagcacgacaccgagggcctgaccatcgagatcctgtccccgatc
gaggccaccaagtactcgatcgagcgcatccgcaagggcgaggacaccatctcggtcacc
ggcaacgtgctgcgcgactacctgaccgacctgttcccgatcctggaactgggcaccagc
gccaagatgctgtccatcgtgccgctgctggcaggcggcggactgttcgagaccggcgcc
ggaggctccgctccgaagcacgtgcagcagctggtgtccgagaaccacctgcgctgggat
tcgctgggcgaattcatggcactgggcgcttccttcgagcacctggcagtcaccaccggc
aacgcccgcgcacaggtcctggcagacaccctggatgccgccaccggcaccttcctgctg
gaagacaagtcgccgaagcgcaaggtcggcgagctggacaaccgcggcagccacttctac
ctggccaagttctgggccgaggaactggccaagcaggacaaggacgccgagctggcatcg
gccttcgccgacgttgccaaggcactgggcgagaacgaggaaaccatcgtggccgaactc
gccgaggtccagggcaagccggtcgacctggcaggctactaccgcccgagcgaggaaaag
accagcgcagtgatgcgtccaagcgccaccttgaacaaggcccttgaactgctgaccaac
gcagtctccaagtaa

DBGET integrated database retrieval system