KEGG   Arthrobacter sp. ATCC 21022: AUT26_14475Help
Entry
AUT26_14475       CDS       T04477                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
arz  Arthrobacter sp. ATCC 21022
Pathway
arz03010  Ribosome
Brite
KEGG Orthology (KO) [BR:arz00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    AUT26_14475
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:arz03011]
    AUT26_14475
Ribosome [BR:arz03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    AUT26_14475
  Bacteria
    AUT26_14475
  Archaea
    AUT26_14475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AMB41274
UniProt: A0A0X4JTP8
Position
complement(3195285..3195650)
Genome map
AA seq 121 aa AA seqDB search
MEAKAIARHIRVTPMKARRVVNLVRGKQANEALAILKFAPQAASEPVFKVLQSAMANARV
LADRDGVAFDDSDLFIIEAFVDEGPTMKRFQPRAQGRAYRIKKRTSHITVVVATPEKEEA
R
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atggaagccaaggcaattgcgcgtcacatccgcgtaacgcctatgaaggcccggcgcgtc
gtcaaccttgttcgtggcaagcaagcgaatgaggctctggcaattctgaagtttgccccc
caggcagcttcggagccggtattcaaggtacttcagtcggcaatggccaacgcccgcgtt
ctcgcggaccgcgatggcgttgcattcgacgacagcgacctcttcatcatcgaagcattc
gttgatgagggcccgaccatgaagcggttccagccgcgtgcccagggccgcgcctaccgc
atcaagaagcggaccagccacatcaccgtggtcgtcgcaaccccggagaaagaggaggct
cgctaa

DBGET integrated database retrieval system