KEGG   Aeromonas salmonicida subsp. salmonicida A449: ASA_0114Help
Entry
ASA_0114          CDS       T00500                                 

Gene name
pncA
Definition
(GenBank) pyrazinamidase/nicotinamidase
  KO
K08281  nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
asa  Aeromonas salmonicida subsp. salmonicida A449
Pathway
asa00760  Nicotinate and nicotinamide metabolism
asa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:asa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    ASA_0114 (pncA)
Enzymes [BR:asa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     ASA_0114 (pncA)
    3.5.1.-  
     ASA_0114 (pncA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Isochorismatase G3P_antiterm
Motif
Other DBs
NCBI-ProteinID: ABO88313
UniProt: A4SHE1
Position
complement(123305..123940)
Genome map
AA seq 211 aa AA seqDB search
MGTVASLDIDAQKGFTPLCPNELPVVGGDDIVAALNAQATLATLRIGSKDSHPANAAWAV
SDPAGMLLPLDLPNADLTWPVHCVPGTQGFELLDGLPAPIDYDFFVWKGVEPDLHPYGTC
FHDLAERRSTGLIEFLQARKVDTVLVGGLATDYCVKTSVLQLRHAGFRVIVHLDACRGIA
PDTVASAHSQMIEAGAELAQTLMDVQRLLDA
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgggaaccgtcgccagcctggatattgatgcgcagaagggatttactcccctctgcccg
aacgaactgcccgtcgtgggcggggatgatattgtggctgcgctcaacgctcaggccacc
ctcgccacgctgcgtattggcagcaaggactcccatcccgccaacgcagcctgggccgtc
agtgacccagccggcatgttgttgccgctggatttgcccaatgccgacctcacctggccg
gtacactgtgtgcccggcacccaaggcttcgagctgctggatggcctgcccgcccccatc
gattacgacttcttcgtctggaagggggtcgagccggatctgcacccctacggcacctgc
ttccacgacctggccgaacggcgcagcacagggctcatcgaatttctgcaggcccgcaag
gtcgataccgtactggtcggcggcctcgccaccgactactgcgtcaagaccagcgtgttg
caactgcgccacgccggttttcgggtgatcgtccatctcgatgcctgccgtggcatagcc
ccggatacggttgccagtgctcactcccagatgatcgaagccggggccgagctggcccag
accctgatggatgtacaacgcctgctggatgcctga

DBGET integrated database retrieval system