KEGG   Aeromonas salmonicida subsp. salmonicida A449: ASA_0228Help
Entry
ASA_0228          CDS       T00500                                 

Gene name
pyrB
Definition
(GenBank) aspartate carbamoyltransferase, catalytic subunit
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
asa  Aeromonas salmonicida subsp. salmonicida A449
Pathway
asa00240  Pyrimidine metabolism
asa00250  Alanine, aspartate and glutamate metabolism
asa01100  Metabolic pathways
Module
asa_M00051  Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Brite
KEGG Orthology (KO) [BR:asa00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    ASA_0228 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ASA_0228 (pyrB)
Enzymes [BR:asa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     ASA_0228 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-ProteinID: ABO88420
UniProt: A4SHP8
Position
complement(241642..242562)
Genome map
AA seq 306 aa AA seqDB search
MTNPLYKKHVISISDLTRPDMELVVATAQRLKAEPDTRLLKDKLIASCFFEASTRTRLSF
ETAVQRLGGNIIGFADGGNTSAKKGETLADSIKIIGSYSDAVVMRHPKEGAARLASEFSR
VPVINGGDGSNQHPTQTLLDLFSIHETQGKLDGLNVAFVGDLKYGRTVHSLAQALSLFNC
RFFFISPDALAMPDYICEELEEKGIRFSVHETMEEVMPELDILYMTRVQKERFDETEYKH
MAAKFVLELATLEGAKPTMKILHPLPRVDEIDVAVDKTPYAYYFQQAENGVYARQALLAL
VLNETV
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgaccaatccactctataagaaacatgtcatctccatttcggacctgacccggcccgac
atggaactggtggtcgcaaccgcacagcggttgaaggccgagcccgacacccgcctgttg
aaagacaagctgattgccagctgcttcttcgaagcgtctacccgtacccgcctctcgttc
gagaccgcggtccagcgcctgggtggcaacatcatcggcttcgccgacggcggcaacacc
agtgccaagaaaggcgagaccctggccgactccatcaagatcatcggctcctactcggat
gcagtggtgatgcgccacccgaaagagggcgccgcccgtctcgcctccgagttctcccgc
gtgcctgtcatcaacggtggtgacggttccaaccagcatccgacccagaccctgctcgac
ctcttctccatccatgagacacaaggcaagctcgatggcctcaacgtagcctttgttggt
gacctgaaatacggccgcacagttcactccctggcccaggccctgagcctgttcaactgc
cgcttcttcttcatctccccggacgcgctggcgatgccggactacatctgcgaggagctg
gaagagaagggcatacggttcagcgtgcacgagaccatggaagaggtgatgccggagctc
gacatcctctacatgacccgggtgcagaaagagcgcttcgacgagaccgaatacaagcac
atggccgccaaattcgtgctggagctggcgaccctggaaggagccaaacccaccatgaag
atcctgcaccccctgccccgcgtcgacgagatcgatgtggcggtcgacaagacgccctac
gcctactacttccagcaggcggaaaacggggtctacgcgcgccaggcactgctggctctg
gtactgaacgaaaccgtctaa

DBGET integrated database retrieval system