KEGG   Aeromonas salmonicida subsp. salmonicida A449: ASA_0735Help
Entry
ASA_0735          CDS       T00500                                 

Gene name
ruvA
Definition
(GenBank) holliday junction DNA helicase RuvA
  KO
K03550  holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
asa  Aeromonas salmonicida subsp. salmonicida A449
Pathway
asa03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:asa00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    ASA_0735 (ruvA)
Enzymes [BR:asa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     ASA_0735 (ruvA)
DNA repair and recombination proteins [BR:asa03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     ASA_0735 (ruvA)
    RecFOR pathway proteins
     ASA_0735 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuvA_N RuvA_C HHH_5 HHH HHH_8 DUF3173 IMS_HHH RHH_1 DUF2497
Motif
Other DBs
NCBI-ProteinID: ABO88897
UniProt: A4SJ25
Position
754771..755385
Genome map
AA seq 204 aa AA seqDB search
MIGRLRGVVIEKQPPEVLLEVGGLGYEVQMPMSCFYDLPEIGKEVTIHTHFVVREDAQLL
YGFNHKQERALFRELIKTNGVGPKLALAILSGMTATQFVLSVEREEISSLIKLPGVGKKT
AERLVVEMKDRLKGWVSHDLFSPAEISLPARESVLRAPDSSEEAASALVALGYKPQQASQ
IVSKIAKEGMSVEDIIRESLRSLV
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
gtgattggtcgcttgagaggcgtagtcattgagaaacaaccccccgaggtgctgctggaa
gtcgggggcctgggttatgaagtacagatgcccatgagctgcttctatgatctgcccgag
atcggcaaggaagtgaccatccacactcacttcgtggtgcgtgaagatgcccagctgctg
tatggcttcaatcacaagcaggagcgggcgctgtttcgcgagctgatcaaaaccaatggc
gtcggccccaagctggcgctggccattctctccggcatgacagccacccagtttgtgctg
agtgtcgagcgtgaggagataagctccctgatcaagttgccaggcgtgggcaagaagacc
gccgagcggctggtggtagagatgaaggacaggctcaagggctgggtcagccacgatctc
ttctcgccggccgagatcagcctgccagccagggagagcgtcctgcgtgctccggattcg
agcgaagaggcggccagtgcactggtggcgcttggctacaagccgcagcaggccagccag
atcgtcagcaagatagccaaagagggaatgtcggttgaagatatcatccgtgaatccctg
cgtagtctggtgtga

DBGET integrated database retrieval system