KEGG   Aeromonas salmonicida subsp. salmonicida A449: ASA_0818Help
Entry
ASA_0818          CDS       T00500                                 

Gene name
galU
Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
asa  Aeromonas salmonicida subsp. salmonicida A449
Pathway
asa00040  Pentose and glucuronate interconversions
asa00052  Galactose metabolism
asa00500  Starch and sucrose metabolism
asa00520  Amino sugar and nucleotide sugar metabolism
asa01100  Metabolic pathways
asa01130  Biosynthesis of antibiotics
Module
asa_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:asa00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    ASA_0818 (galU)
   00052 Galactose metabolism
    ASA_0818 (galU)
   00500 Starch and sucrose metabolism
    ASA_0818 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    ASA_0818 (galU)
Enzymes [BR:asa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     ASA_0818 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD CTP_transf_3
Motif
Other DBs
NCBI-ProteinID: ABO88967
UniProt: A4SJ95
Position
complement(837356..838267)
Genome map
AA seq 303 aa AA seqDB search
MKKTQLVVRKAVLPVAGLGTRMLPATKAIPKEMLPVVDKPLIQYVVREAIAAGIKEIILV
THSSKNSIENHFDKSFELEATLEKRVKRQLLEEVQHICPKDVTIMHVRQGEAKGLGHAIL
CARPLIGDNPFAVLLPDVLIDDMASNLKRDNLAEMVHMFEGDQISQIMVEAVPDSEVDKY
GIADIKGEALTEGMSLPMQAIVEKPPRDEAPSNLAVVGRYVLSANIWPLLERTPVGAGDE
IQLTDAIAMLMEHEQVNAYFMKGRSHDCGSKMGFMKANVEYAVRHPELNGEFTAWLKQFV
KQL
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagacacagctcgttgtacgcaaggccgttcttcctgtcgccggtttgggcacc
cgtatgctgcctgccaccaaggccatccccaaagagatgctgcccgtggtcgacaaaccg
ctgatccagtatgtggtgcgtgaagccatcgctgccggcatcaaggagatcatcctggtg
acccactcgagcaagaactccatcgagaaccacttcgacaagagcttcgaactagaagcc
accctggagaagcgggtcaagcggcagctgctggaggaggtgcaacacatctgccccaaa
gatgtcaccatcatgcatgtgcgccagggcgaggccaaaggtctgggccatgccatcttg
tgtgcccgcccgctgatcggcgacaaccccttcgccgtgctgctgccggacgtgctgatc
gatgacatggccagcaacctcaagcgcgataacctggcagaaatggtacacatgttcgaa
ggggatcagatcagccagatcatggtggaagcggttcccgacagcgaagtggacaagtac
ggtatcgccgatatcaagggcgaagccctgaccgagggcatgtccctgccaatgcaggcc
atcgtcgagaagccgccccgtgacgaggccccttccaatttggccgtggtcggccgctac
gtgctgtcagccaacatctggccactgctggagcgcacccctgtcggtgcaggtgacgag
atccaactgaccgacgccatcgccatgctgatggaacatgagcaggtcaacgcctacttc
atgaaaggacgcagccacgactgcggcagcaagatgggtttcatgaaagccaatgtggaa
tacgcggtacgccatccggaactgaacggtgaattcaccgcctggctgaagcagtttgtc
aaacagttgtaa

DBGET integrated database retrieval system