KEGG   Aeromonas salmonicida subsp. salmonicida A449: ASA_0893Help
Entry
ASA_0893          CDS       T00500                                 

Gene name
proB
Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
asa  Aeromonas salmonicida subsp. salmonicida A449
Pathway
asa00330  Arginine and proline metabolism
asa00332  Carbapenem biosynthesis
asa01100  Metabolic pathways
asa01130  Biosynthesis of antibiotics
asa01230  Biosynthesis of amino acids
Module
asa_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:asa00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    ASA_0893 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    ASA_0893 (proB)
Enzymes [BR:asa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     ASA_0893 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA Glyco_trans_4_4 Glyco_transf_4 PT-VENN
Motif
Other DBs
NCBI-ProteinID: ABO89027
UniProt: A4SJF5
Position
923425..924528
Genome map
AA seq 367 aa AA seqDB search
MENRTIVVKLGTSVLTGGSSQLNRAHMVELVRQCAALHRHGHRVVVVTSGAIAAGREHLG
HPPLAPTLPNKQMLAAVGQTQLIRVWQDLFNLYGLHIGQMLLTRADLEDRERYLNARDTL
RTLLDHRIIPVINENDAVATAEIKVGDNDNLSARAAILADADLLILLTDQTGLFTADPRS
NPDAQLIEEVQTIDDTLRKLAGGSVGGLGTGGMATKLQAADVARRAGVKVVIATGQMPEV
IGRLARGERIGTLFPALASPLEGRKSWILAGPPPHGEVQVDQGAVAAMQDKGSSLLPKGI
VSVKGDFVRGDVVRILDPKGVELARGICRYDHVELNKLRGVHSDSIEQVLGYGYGAVAIH
RDDMVLL
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atggaaaacagaaccatagtcgtcaaactgggcaccagcgtgctcacagggggatcttcc
cagcttaaccgtgcccacatggtggagctggtcagacagtgtgccgccttgcatcgtcac
ggccatagagtcgtggtggtcacctcgggggccattgccgccgggcgtgaacatctgggc
caccctccgctggcgccgactctgcccaacaagcagatgctggcggcggtaggccagacc
cagctcattcgggtatggcaggacttgttcaacctctatgggctgcatatcggtcagatg
ttgctgacccgcgccgatctggaggacagggagcgttacctcaacgctcgcgatacgctg
cgaaccctgctcgatcatcgcatcattcccgtcatcaacgagaacgacgccgtggcaacc
gctgagatcaaggtgggagacaacgacaacctctcggctcgtgccgctatcctggctgat
gccgatctgctgatcctgctgaccgatcagacgggtttgttcaccgccgatccgcgcagt
aaccctgatgcacaattgatagaagaggtgcagaccatagacgacacgctgcgcaagttg
gcgggtggcagtgtcggcgggctcggcactggcggcatggcaaccaagctgcaggcggcc
gatgtggcgcgccgtgccggggtcaaggtggtgatcgctaccggccagatgcccgaggtg
atcggtcgtctcgccagaggtgagcgtatcggtaccctgttcccggcgctcgcttccccg
ctggaagggcgcaagagctggattttggcaggcccgcccccgcacggtgaagtccaggtc
gatcaaggcgctgttgccgccatgcaggacaaaggctccagcctgctgcccaaggggatc
gtttccgtgaagggcgacttcgtccggggcgacgtggtgcgcattctcgatcccaaaggc
gtcgagctggcgcggggcatctgtcgctatgatcacgtagagctcaacaagctgcgcggc
gtgcattcggacagcatcgagcaggtattgggttacggctatggtgccgtggccattcac
agagatgatatggtactgctctaa

DBGET integrated database retrieval system