KEGG   Aeromonas salmonicida subsp. salmonicida A449: ASA_1002Help
Entry
ASA_1002          CDS       T00500                                 

Gene name
folP
Definition
(GenBank) dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
asa  Aeromonas salmonicida subsp. salmonicida A449
Pathway
asa00790  Folate biosynthesis
asa01100  Metabolic pathways
Module
asa_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:asa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    ASA_1002 (folP)
Enzymes [BR:asa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     ASA_1002 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind
Motif
Other DBs
NCBI-ProteinID: ABO89131
UniProt: A4SJQ9
Position
1032367..1033212
Genome map
AA seq 281 aa AA seqDB search
MQLISKGLSLSLERPHVMGILNVTPDSFSDGGHFSQIERAMAHARQMVSDGATLIDIGGE
STRPGAPDVNEQEELDRVIPVVERLVAELDVMISLDTSKAAVMREGCKAGAHLINDVRAL
LEPGALAVAAEADVPVCLMHMQGQPRTMQAEPHYDDLLGEVRAFFDERIAACLAVGIRRQ
QLLLDPGYGFGKTLAHNYQLLAQQSKLLDYQLPLLVGMSRKSMIGNLLGRPVDDRLAGSL
ACALIGMQHGARIIRVHDVRETMDALRAGWMVMTGQDFISK
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgcagctaatcagcaaagggctcagcctctccctcgaacgcccccatgtcatggggatc
ctcaatgtcaccccagactccttctccgatggcggtcatttcagtcagattgaacgggcg
atggcccatgcgcgtcagatggtctctgacggggcaacacttatcgatattggtggcgag
tcgacccgtcctggcgcccctgacgtgaacgaacaggaagagctggacagggtgatcccc
gtggtcgagcggctggtcgccgagctggatgtgatgatatccctcgatacctccaaggct
gccgtgatgcgcgaaggttgcaaggcgggagcccatctcatcaatgatgtcagggcgctg
cttgaacccggcgccctggcggttgccgcagaagctgacgtaccagtgtgtctgatgcac
atgcaaggccaaccgagaaccatgcaggcggaaccccattatgatgacctgctgggggag
gtgagggctttcttcgatgagcgtattgccgcctgtctggccgtcgggatacggcgccag
cagttgttgctggacccgggctacggctttggcaagacgctggcacacaactatcaacta
ctggcacagcagagcaagttgctcgattaccagcttccgctcttggtcggcatgtcgcga
aagtctatgataggcaacctgcttggccgaccggttgatgatcggttggccggcagcctg
gcctgcgcgctcatcgggatgcaacatggtgcccggatcatccgggtgcacgatgtgcga
gagactatggatgccctgcgcgctggctggatggtaatgacgggacaagatttcatatcc
aaataa

DBGET integrated database retrieval system