KEGG   Aeromonas salmonicida subsp. salmonicida A449: ASA_1779Help
Entry
ASA_1779          CDS       T00500                                 

Gene name
hns
Definition
(GenBank) histone-like nucleoid structuring protein
  KO
K03746  DNA-binding protein H-NS
Organism
asa  Aeromonas salmonicida subsp. salmonicida A449
Brite
KEGG Orthology (KO) [BR:asa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:asa03036]
    ASA_1779 (hns)
   03400 DNA repair and recombination proteins [BR:asa03400]
    ASA_1779 (hns)
Chromosome and associated proteins [BR:asa03036]
 Prokaryotic Type
  Nucleoid associated proteins
   HNS (histone-like nucleoid structuring protein)
    ASA_1779 (hns)
DNA repair and recombination proteins [BR:asa03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     Supressor
      ASA_1779 (hns)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histone_HNS DUF4355 Pex19 RhlB
Motif
Other DBs
NCBI-ProteinID: ABO89858
UniProt: A4SLT6
Position
complement(1860186..1860593)
Genome map
AA seq 135 aa AA seqDB search
MNEFLKVLLNIRSLRAACRELTLEQLEEGLEKLSAIVAERQQDEVADRQAREEHQRKINE
YTEMLKAAGIDPAELVGTVANEPAKAAKKGKRAPRPAKYRYLDNGVEKTWTGQGRMPSAI
AKAVAEGKSIEEFAI
NT seq 408 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaatttttgaaagtactgctgaatatccgtagcttgcgcgcagcgtgccgtgag
ttgactctggaacaattggaagaaggcctggaaaaactctctgctattgttgccgaacgt
cagcaggatgaagtcgccgatcgtcaggcccgtgaagaacatcagcgcaaaattaacgaa
tataccgaaatgctgaaagccgctggcattgatcctgccgagctggttggcacagtggct
aacgagccagccaaggctgcgaaaaaaggcaagcgtgccccacgccctgccaaataccgc
tatctggataatggtgttgaaaaaacctggaccggtcagggccgtatgccttccgcgatt
gccaaggccgttgccgaaggcaaatccatcgaggaatttgccatctga

DBGET integrated database retrieval system