KEGG   Aeromonas salmonicida subsp. salmonicida A449: ASA_1782Help
Entry
ASA_1782          CDS       T00500                                 

Gene name
tdk
Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
asa  Aeromonas salmonicida subsp. salmonicida A449
Pathway
asa00240  Pyrimidine metabolism
asa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:asa00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    ASA_1782 (tdk)
Enzymes [BR:asa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     ASA_1782 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_22 AAA_30 DUF2075 PIN_2 AAA_19
Motif
Other DBs
NCBI-ProteinID: ABO89861
UniProt: A4SLT9
Position
1864017..1864598
Genome map
AA seq 193 aa AA seqDB search
MASLHYKFATMNSGKSTQLIQAHFNYLERGMQPLAMTPAIDDRFGAGVISARVGLELKVE
VFSDTCDLFDMVKARHAVKRIDVFIVDEAQFLTREQVYQLARIVDEQDIPVIAYGLKTDF
RGELFPGSYHLLCLADKFEELKSICWCGNKAHMNSRVSEAGQVMRDGEQVEIGGNDRYVS
LCRKHYLAGRAYK
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggcttcactgcactacaaatttgccaccatgaattcaggcaaatccacccagctcatc
caggcccacttcaattatctggagcgtggcatgcagcccctggccatgacaccggccatc
gacgatcgcttcggcgccggagtgatcagtgcccgggttggattggagttgaaggtggag
gtgttcagtgatacctgcgatctgttcgacatggtcaaggcgcgccatgcagtaaaacgc
atcgatgtgttcatcgtcgatgaggcccagtttctgacccgcgaacaggtctaccagctg
gcccgcattgtcgatgagcaggatattccggtgatcgcctatggcctgaagaccgacttt
cggggggagctgttccccggctcctaccatctgctatgcctcgctgacaagtttgaggag
ctcaaaagcatctgctggtgtggcaacaaggcccacatgaactcacgggtgagcgaagca
gggcaggtgatgcgcgatggggagcaggtggagataggcggcaacgatcgctatgtgtcc
ctgtgccgcaagcactatctggccgggcgggcatataaatag

DBGET integrated database retrieval system