KEGG   Aeromonas salmonicida subsp. salmonicida A449: ASA_1783Help
Entry
ASA_1783          CDS       T00500                                 

Definition
(GenBank) conserved hypothetical protein
Organism
asa  Aeromonas salmonicida subsp. salmonicida A449
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1704 UDPG_MGDP_dh BioW
Motif
Other DBs
NCBI-ProteinID: ABO89862
UniProt: A4SLU0
Position
complement(1864658..1865995)
Genome map
AA seq 445 aa AA seqDB search
MTIQEKYRLHLKSLSDELLTLQKPIRILDAIKWPRHLQAEFLAKGGRELPAIGQHFYETL
PLGFDPRNKYLELKELRDRIRRKLGPQDDLGRILQETVDQYMVVIEMLRQRGQPDFLRYS
QLLYGSASDHLRGDRKTLKELGARLCDIFSLPGARHLVRPYPKEFEGEAAVAKLQGKLSS
YFSEGTVQVKLSDGIVSDAAAGGDYIKLSSHARFSELDLQVLEVHEGWVHVGTTLNGRQQ
PYATWLSAGSPRITACQEGLAVLIETLTFSSFPDRAKRISDRVMAIDMAEHGADFVEVFQ
HFVKQGTSEHDAYKITQRVFRGGMVEGGACFTKDLSYVRGYVETVNFIRSAVLEGVPEIL
PMLFVGKVTLDDIPVLYQHYLEGLIDAPRYLPPMFRDLTGLYVWFGFASGMSLVDIGRVQ
HHFRQLFHRLPVADPIIAPVDIEID
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgaccatccaagaaaagtatcgcctgcatctgaaatccctctccgatgaactgctgact
ctgcaaaagcccatccgtattctggatgccatcaagtggccccgtcatcttcaggccgag
tttctggccaaggggggacgagagttgcccgccatcggccagcacttctacgaaaccctc
ccccttggcttcgatccacgcaacaagtatctggagctcaaggagctgagggacaggatc
cgcagaaagctgggcccccaggacgatctgggccgcatcctgcaagaaacggtcgatcag
tacatggtggtgatcgagatgctccgccagcgcgggcaacctgatttcctgcgctacagc
caattgctctatggctccgccagcgaccacctgcgcggcgatcgcaagaccctcaaggag
ctgggtgcccgtctgtgcgatatcttttccctgcccggcgcccgtcatctggtgcgcccc
tatcccaaggaattcgagggagaagcggcggtcgccaagctgcagggaaagctgtcgagc
tacttcagcgaggggactgtgcaggtcaagttgagcgatggcattgtctcggatgccgcc
gccggcggggattacatcaagctcagctcccacgcccgcttctccgagctggatctgcaa
gtgctagaagtacacgaaggctgggtccacgtgggcacgaccttgaacggccgccagcaa
ccctacgccacctggctcagtgccggctcgccgcggatcaccgcttgtcaggaggggctg
gcagtattgattgaaaccctcaccttcagctcctttccggatcgggccaagcgtatctcg
gacagggtgatggccatcgacatggcggagcatggcgccgactttgtcgaagtgttccag
cactttgtgaaacaaggcaccagcgagcacgatgcctacaagatcactcagcgggtattt
cgcggcggcatggtcgaagggggggcctgctttaccaaggatctctcctacgtgcgtggc
tacgtggaaacggtcaacttcattcgcagcgccgtgctggaaggggtacctgaaatcctg
cccatgctgttcgtcggcaaggtgacgctggatgacattcccgtgctctatcagcactat
ctggagggcttgatcgatgccccccgctatctgccccccatgtttcgcgacctcaccgga
ctctatgtctggtttggtttcgcctccggcatgtctctggtggacataggccgggtacag
caccattttcgccaactgtttcaccgcctgccggtggccgaccccatcatagcgccggtg
gatatagagatagactga

DBGET integrated database retrieval system