KEGG   Aeromonas salmonicida subsp. salmonicida A449: ASA_1784Help
Entry
ASA_1784          CDS       T00500                                 

Definition
(GenBank) conserved hypothetical protein
Organism
asa  Aeromonas salmonicida subsp. salmonicida A449
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YbjN
Motif
Other DBs
NCBI-ProteinID: ABO89863
UniProt: A4SLU1
Position
1866148..1866609
Genome map
AA seq 153 aa AA seqDB search
MEMMNIPSSEMIMRWLQQARIEHYVCDQCHGIHIVSLQSVDGIQESRIFVEEEGLLFSSE
LEVRPSALLPLMAELGRLNMQYPSLKVFLDIIDDNLPRLIVGHTVFTKAGLSVEQFLLFV
ESTTAATHEVVSECERLGFLNLPEIQVGSESVH
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
gtggaaatgatgaatatccccagctctgaaatgataatgcgttggttgcagcaggctcgc
atcgagcactatgtttgcgaccagtgtcatggcatccacattgtctccctgcagtctgtc
gacggcattcaggagagccggatctttgtcgaagaggaagggttgctgttttcatccgaa
ctggaagtgcgcccttcggcgctgctgccgctgatggccgaactgggtcgtctcaacatg
caatacccctcgctcaaggtgttcctcgatattatcgacgacaacctgccgcgcctcatc
gtcggtcacactgtcttcaccaaggcgggcctctccgtggagcagttcctgttgttcgtt
gaaagcaccacggccgcgacccacgaagtggtctctgaatgcgagcgccttggcttcctg
aatctgcctgaaatacaggtcggatccgaatctgtgcattga

DBGET integrated database retrieval system