KEGG   Aeromonas salmonicida subsp. salmonicida A449: ASA_1787Help
Entry
ASA_1787          CDS       T00500                                 

Definition
(GenBank) hypothetical protein
Organism
asa  Aeromonas salmonicida subsp. salmonicida A449
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ABO89865
UniProt: A4SLU3
Position
complement(1868891..1869205)
Genome map
AA seq 104 aa AA seqDB search
MATPYHKHANQRLIRQPSSLPRRPCLYILPCSKYLRHIIAHQHRVSRIRHTEIMEKRGET
TVDFSLVAMPPCDPPGAIRFLAADRNNSPTRKRDRNHQPKNIGR
NT seq 315 nt NT seq  +upstreamnt  +downstreamnt
atggcgacaccgtatcataagcacgccaaccaacgactcatacgacagccttcatcattg
cctcggaggccctgcttgtacatattgccctgttccaaatacctgcgacatatcatcgct
catcaacacagggtttctcgtatcaggcatacagagataatggaaaagaggggggaaacc
actgtggatttttctcttgtcgctatgcccccttgcgatcctccgggagcaattcgtttc
ctggctgcagacagaaataattccccgacaagaaaacgcgatagaaatcaccagccaaaa
aacattggcagatga

DBGET integrated database retrieval system