KEGG   Aeromonas salmonicida subsp. salmonicida A449: ASA_1796Help
Entry
ASA_1796          CDS       T00500                                 

Gene name
dppC
Definition
(GenBank) ABC-type dipeptide/oligopeptide/nickel transporter, permease component
  KO
K02034  peptide/nickel transport system permease protein
Organism
asa  Aeromonas salmonicida subsp. salmonicida A449
Pathway
asa02024  Quorum sensing
Module
asa_M00239  Peptides/nickel transport system
Brite
KEGG Orthology (KO) [BR:asa00001]
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    ASA_1796 (dppC)
Transporters [BR:asa02000]
 ABC Transporters, Prokaryotic Type
  Peptide and nickel transporters
   Peptides/nickel transporter [MD:M00239]
    ASA_1796 (dppC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: ABO89874
UniProt: A4SLV2
Position
1878518..1879333
Genome map
AA seq 271 aa AA seqDB search
MLFNPLPSIVRLGVALIGLALLAAYGWSLSAQDVPMDLLARQQAPSLAHWFGTDQMGRDL
WLRAFQGTLTSLELGISTALCSGLLAMVAASVSLIHPRCDVAVRLVIDAMLALPHMLLLI
LICFTVGGGMRGVILAVALTHWPKLALILCAAARRIACSDYMVLARCQGMGALRRWRTHL
LPGLLPQWFIGTLLMFPHAVLHSAALSFLGFGLAAHEASLGLLLADALRYLAGGGWWLAL
FPGLMLLLLVLLFDLATRALQQLLWHRSEPC
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgctgtttaatccgcttccctccatagtgcgcctcggcgtggcgctgataggattggcg
ctgctggccgcctacggctggagcttgtcggctcaggatgtgcccatggatctgctggct
cgtcagcaggctccgtcgctggcgcattggttcgggaccgaccagatggggcgggatctc
tggttgcgggcctttcagggtaccctcaccagtctggagctggggatcagcacggccctg
tgcagcgggctgctggccatggtggcggcaagcgtgtcgcttattcatcccagatgcgat
gtggcggtgcgcctcgtgatcgacgccatgctggcgttgccccatatgctgctgctgatc
ctgatctgctttaccgtggggggcggcatgcgcggggtgatcctggcggtggcgctcacc
cactggcccaagctggcgctgatcctctgcgcggcggcgcggcggatcgcctgcagcgac
tacatggtgctggcccgctgtcaggggatgggggcgctgcgtcgctggcgcacccacctg
ctgccggggctgttgccccagtggtttatcggtaccctgctgatgttcccccatgcggtg
ctgcacagcgcggctttgagctttctcggctttggtctggcggcccacgaggcctctctt
ggcctgctgctggccgatgccctgcgttatctggccggtggcggctggtggctggccctc
ttcccgggcctgatgttgctgctgctggtactgctgtttgatctggctacccgcgccctg
caacagctgctgtggcacaggagtgaaccatgttga

DBGET integrated database retrieval system