KEGG   Aeromonas salmonicida subsp. salmonicida A449: ASA_1802Help
Entry
ASA_1802          CDS       T00500                                 

Gene name
hypD
Definition
(GenBank) hydrogenase expression/formation protein HypD
  KO
K04654  hydrogenase expression/formation protein HypD
Organism
asa  Aeromonas salmonicida subsp. salmonicida A449
Brite
KEGG Orthology (KO) [BR:asa00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99975 Protein processing
    ASA_1802 (hypD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HypD
Motif
Other DBs
NCBI-ProteinID: ABO89880
UniProt: A4SLV8
Position
complement(1883255..1884373)
Genome map
AA seq 372 aa AA seqDB search
MLTLNDLFQGFRQPEVIRALAAQITELAKDLPEPLRVMEVCGGHTHTIMKYGLPQLLPAS
IEFVHGPGCPVCIMPKERIDQAIELAREPNVILVTLGDMIRVPGSKGTLAQQRAKGSDIR
PVYDPLDALRIAKENPEKTVVFFAIGFETSTPMTAALLAAADAAGVENLLFHINHVLVPP
AIHAVMADGVAKVNAFIGPSHVSVITGADIYLPIVDRYQVPVVVSGFEPVDVMEALLMMV
RQKVEGRYALEVQYSRAVTASGNRAAQRLVDQYFETREHFRWRGLGDINASALRLRDAFA
RRDAERHFQLSETPIDDHKACQCADILRGLAKPNQCKVFGRGCTPTQPMGSCMVSSEGAC
NAYYRYMGIQQQ
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgctgaccctcaatgatctctttcagggctttcgccagcccgaggtgatccgcgccctc
gccgcgcaaattaccgaactggcaaaggatctgcccgagccgctgcgggtgatggaggtg
tgcggcggccatacccacaccatcatgaaatacggactgccccagttgctcccggccagc
atagagttcgtccacggccccggctgcccggtctgcatcatgcccaaggaacgcatcgat
caggccatcgagctggctagagagcccaacgtcattctggtcaccctgggggacatgatc
cgggtgccgggctccaagggcacgctggcccagcagcgggccaaggggagcgatatccgc
cccgtctatgaccccctcgatgccctgcgcatcgccaaggagaacccggaaaaaaccgtg
gtcttcttcgccatcggtttcgagacctccacccccatgacagccgcgctgctggcagca
gccgacgctgcgggggtggagaacctgctgtttcatatcaaccatgtgctggtaccgccc
gccatccacgccgtgatggccgacggggttgccaaggtgaacgcctttatcggtccctcc
cacgtcagcgtcatcacaggtgccgatatctaccttcccatcgttgatcgctatcaggtg
cctgtggtggtgagcggcttcgagccggtggatgtgatggaggcgctgctgatgatggtg
cgccagaaggtggagggtcgctacgcgctggaggtgcagtacagccgcgccgtcaccgcc
agcggcaaccgggccgcccagcggctggtcgaccaatattttgagacccgcgagcacttt
cgctggcgaggtctcggggacatcaacgcctccgccctgcgcctgcgcgatgcctttgcc
aggcgcgatgcggagcgccactttcaactcagtgagacccccatcgatgatcacaaggcg
tgccagtgcgccgacattctgcgcgggctggccaagccgaaccagtgcaaggtctttggc
cggggctgcaccccgacccagcccatgggcagctgcatggtcagctccgagggagcctgc
aatgcctactaccgctatatggggatccagcagcaatga

DBGET integrated database retrieval system