KEGG   Aeromonas salmonicida subsp. salmonicida A449: ASA_1809Help
Entry
ASA_1809          CDS       T00500                                 

Gene name
hycH
Definition
(GenBank) formate hydrogenlyase maturation protein
  KO
K15834  formate hydrogenlyase maturation protein HycH
Organism
asa  Aeromonas salmonicida subsp. salmonicida A449
Brite
KEGG Orthology (KO) [BR:asa00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99973 Transcription
    ASA_1809 (hycH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HycH
Motif
Other DBs
NCBI-ProteinID: ABO89886
UniProt: A4SLW4
Position
complement(1891504..1891917)
Genome map
AA seq 137 aa AA seqDB search
MADQVFFYRLSRKFVDEQFDVPEEAKEVMYYSLAIGHHLGIVDCLSADLVCPLTGYRDWV
AKLPAGSEARRKMEGFLTFGEITIYREHCHMLACAFDRLRKADNVLDELQLGWTNTFMDQ
LTALYNDPHMYLMVRSR
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atggctgaccaagttttcttctaccgcctttcgcgcaagtttgtcgacgagcagttcgat
gtgccggaagaagccaaagaggtgatgtactacagcctcgccatcggccatcacctcggc
attgttgactgcctcagtgccgatctggtctgcccgctaacgggttatcgcgactgggtg
gccaagctgccagccggcagcgaggcccgccgcaagatggaggggtttctcacctttggc
gagatcaccatctatcgggagcactgccatatgctggcctgcgctttcgatcggttgcgc
aaagccgacaatgtgctggatgagctgcagctgggctggaccaacacctttatggatcag
ctcaccgctctctataacgatccccatatgtacctgatggtaaggagccgctga

DBGET integrated database retrieval system