KEGG   Aeromonas salmonicida subsp. salmonicida A449: ASA_1810Help
Entry
ASA_1810          CDS       T00500                                 

Gene name
hyfI
Definition
(GenBank) hydrogenase-4 component I
Organism
asa  Aeromonas salmonicida subsp. salmonicida A449
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Oxidored_q6
Motif
Other DBs
NCBI-ProteinID: ABO89887
UniProt: A4SLW5
Position
complement(1891910..1892725)
Genome map
AA seq 271 aa AA seqDB search
MSKIKGIEPVVGHAHTRAVPLAQDPEITKLKKTLLKDIRRSAYVYRVDCGGCNACEIEIF
ATITPLFDAERFGIKVVASPRHADILLFTGAVTRAMRVPALRAYEAAPDPKICIAYGACG
CDGGIFHDLYCVWGGTDKIVPVDVYIPGCPPTPAATIYGFAVALGLLEQKLTATSHEVQP
GERIELRHTGIPNEIRVMIEREARRMAGYRQGQIIADEFMALLEGATQQDVDLRIQSYLD
QHDDPRLSEIVNNLANACLNRAAGKGEAVHG
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagatcaaaggcatagaaccggttgtcggccatgcccatacccgcgccgtgccg
ctggcacaggatcccgagatcaccaaactcaagaagaccctgctcaaagacattcgccgc
tcggcctatgtctatcgggtcgattgcggcggctgcaacgcctgcgagatcgagatcttc
gccaccatcaccccgctgttcgatgccgagcgcttcggcatcaaggtggtcgcctccccc
cgccacgccgacatcctgctctttaccggcgcggtaacccgggcgatgcgggtgcctgcc
ctgcgcgcctatgaagcggcccccgatcccaagatctgcatcgcctacggcgcctgcggc
tgtgacggcggcatcttccacgatctctactgcgtctggggcggcaccgacaaaatcgtg
ccggtggatgtctatatcccgggctgcccgcccacgcctgccgccaccatctacggcttt
gccgtggcgctcggtctgcttgagcagaaactgaccgccaccagccacgaggtgcaaccg
ggtgagcggatcgagctgcgccacaccggcatccccaatgaaatccgggtgatgatcgag
cgcgaagcgcgccgcatggccggttaccgtcagggacagatcatcgccgacgagtttatg
gcgctgctcgaaggggcgacccagcaggatgtggatctgcgcatccagagctacctcgat
cagcacgacgacccgcgcctgtcggagatcgtcaacaacctggccaacgcctgcctcaac
cgggcagcaggcaagggagaggctgtgcatggctga

DBGET integrated database retrieval system