KEGG   Aeromonas salmonicida subsp. salmonicida A449: ASA_1816Help
Entry
ASA_1816          CDS       T00500                                 

Gene name
kup
Definition
(GenBank) potassium uptake protein
  KO
K03549  KUP system potassium uptake protein
Organism
asa  Aeromonas salmonicida subsp. salmonicida A449
Brite
KEGG Orthology (KO) [BR:asa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:asa02000]
    ASA_1816 (kup)
Transporters [BR:asa02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   ASA_1816 (kup)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: K_trans
Motif
Other DBs
NCBI-ProteinID: ABO89893
UniProt: A4SLX1
Position
complement(1899189..1901015)
Genome map
AA seq 608 aa AA seqDB search
MSCDNKQALSGVTLAAIGVVYGDIGTSPLYTLRECLSGQFGIRAEPAAILGFLSLIFWLL
ILVVSVKYLSFVMRADNAGEGGILTLMSLATRNASPRWTPVLIILGLIGGSFFYGEVVIT
PAMSVMSAIEGLSLMAPSLDPYIVPLSVLVLTLLFAIQKHGTAMVGKLFAPIMLTWFLTL
AVLGLRSIIQNPEVLGALNPIWALRFFAEYQTTSFFALGAVVLAITGVEALYADMGHFGK
NPIRLAWFVVVLPSLVLNYFGQGALLLDNPAAIANPFFLLAPKWALLPLLVLATMATVIA
SQAVISGVFSLTRQAVRLGYLSPIRIVHTSEQESGQIYIPVINWILYISVVIVIMSFEHS
SNLAAAYGIAVTGTMVLTSILFCSVAKNSWHWPTYLVAALFALLLAIDVPLFAANLGKIF
SGGWLPLTLGAVMFTLMTSWKSERFQLIRRLNEHGNSLEPMIASLEKSPPTRVAGTAVYM
SRVVNVIPHALLHNLKHNKVLHERIILLTLRVEDVPYVHNVRRVCIEQLSPTFWRVVASY
GWRETPNMEEIFHRCNAEGLSCRMMETSFFMAHESLIMKERPCAANCLCCCSATPCAQRI
SSRSRPIG
NT seq 1827 nt NT seq  +upstreamnt  +downstreamnt
atgagctgtgataacaaacaagccctgtccggcgtcacgctggcggcgattggcgtggtc
tatggtgatatcggcaccagccccctctataccctgcgagagtgcctgtcgggtcaattc
gggattagggccgaacccgccgccatcctgggatttctctccctcatcttctggctgctg
atcctggtggtctcggtcaagtacctctccttcgtgatgcgggccgacaatgccggtgaa
gggggcattctcaccctgatgtcgctggccacccgcaacgcctctccccgctggacgcca
gtgctgatcatcctcgggctgattggcggcagtttcttctatggggaggtggtgatcacc
ccggccatgtcggtgatgtcggccatcgagggcttgagcctgatggccccctcgctcgac
ccttatatagtgccgctctcggtgctggtgctgaccctgctgtttgccattcaaaaacat
ggcaccgccatggtgggcaagctgttcgcccccatcatgctcacctggtttctgaccctg
gccgtgctgggactgcgcagcatcatccagaatcccgaggtgctgggagcactcaacccc
atctgggcgctgcgcttcttcgccgagtaccagaccacctcgttttttgccctcggcgcc
gtggtgctggccatcacaggggtggaggcgctctacgccgacatgggccactttggcaag
aacccgatccggctcgcctggtttgtggtggtgctgccctccctggtgctcaactacttc
gggcaaggcgcgctgctgctggacaacccggcggccatcgccaaccccttcttcctgctc
gctcccaaatgggcgctgctgccgctgctggtgttggcgaccatggcgaccgtgatcgcc
tcccaggcggtgatctccggggtcttctccctcacccggcaggcggtgcggctcggttat
ctctcacccatccgcatcgtccacacctccgagcaggagtccggccagatctatattccc
gtcatcaactggatactctatatctctgtggtgatcgtcatcatgagcttcgagcactcc
agcaatctggcagcggcctacggcatcgccgtcaccggcaccatggtgctcacctccatc
ctcttctgctccgtggccaagaacagctggcactggcccacctatctggtggctgccctg
ttcgccctgctgctggccatcgacgtgccgctgtttgccgccaacctgggcaagatcttc
tccggtggctggctgccgctcaccctgggcgccgtcatgttcaccctgatgaccagctgg
aagagcgagcgcttccagcttattcgccgcctgaacgagcacggcaattcgctggagccc
atgatcgcctcgctggaaaaatccccgccgacccgggtggcaggcaccgccgtctatatg
tcgcgtgtggtcaatgtgatcccccatgcgctgctccacaacctcaagcacaacaaggtg
ctgcacgagcggataatcctgctcaccctgcgggtggaggatgtgccctacgtccacaac
gtgcgccgggtctgcatagagcagctctcccccaccttctggcgggtggtggccagctac
ggttggcgcgagacccccaacatggaggagatcttccaccgctgcaacgccgaggggctg
agctgccgcatgatggaaacctcgttctttatggcccacgagtcgctgatcatgaaggag
cgtccctgcgcggcaaactgtttatgctgctgcagcgcaacgccctgcgcgcagcggatc
agttcgagatcccgcccaatcgggtga

DBGET integrated database retrieval system