KEGG   Aeromonas salmonicida subsp. salmonicida A449: ASA_1820Help
Entry
ASA_1820          CDS       T00500                                 

Gene name
hydN
Definition
(GenBank) electron transport protein
  KO
K05796  electron transport protein HydN
Organism
asa  Aeromonas salmonicida subsp. salmonicida A449
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4_6 Fer4_7 Fer4 Fer4_9 Fer4_2 Fer4_11 Fer4_16 Fer4_10 Fer4_3 Fer4_4 Fer4_21 Fer4_8 IMS Fer4_17 GF_recep_IV
Motif
Other DBs
NCBI-ProteinID: ABO89896
UniProt: A4SLX4
Position
1905375..1906064
Genome map
AA seq 229 aa AA seqDB search
MNSFVIADPSLCIGCRTCEVACAVSHQSTSCAGTVEREGGLRLAIEDGHLVSKDSYFQPR
LKVIVGSKVTTPVLCRQCEDKPCAVACPNNAIVSEDGCVKVLQARCIGCKSCVVACPYGA
MAVVVKEVAPAADALFKRPQTKAQALKCDLCRHREAGPACVEVCPTQALRLVTPESLGEL
NRQKQLASASRSWHKGNALDGVRRPLLAAACASVLSIPDKPFSLKAFYR
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgaacagcttcgtgattgcagatcccagtctttgtattgggtgtcgtacctgtgaggtg
gcctgcgccgtgtcacaccagtcaacgtcctgcgcgggtaccgttgagcgggagggcggc
ctgcgtcttgccatcgaggatggacatctggtctccaaggacagctatttccagccgcgc
ctgaaggtgatcgtcggcagcaaggtgaccacgcctgtgctgtgccgccagtgtgaagac
aagccgtgtgctgtggcctgccccaacaatgccattgtcagtgaggatggttgcgtcaag
gtgctgcaggcgcgctgcatcggctgcaaatcctgcgtggtggcctgtccttacggtgcc
atggcggtggtggtgaaagaggtggcgcccgctgccgatgcgctgttcaagcgcccgcag
accaaggcgcaagccttgaagtgcgatctctgccgtcaccgtgaagcgggcccggcctgt
gtcgaggtgtgcccgacccaggcgctgcgcttggtgaccccggaatccctcggcgagctg
aaccgccagaagcagttggccagcgccagccggtcttggcacaagggtaatgcattggat
ggcgtgcgcaggcccttgctggccgccgcttgcgcctctgtgctctctatccctgacaag
ccattttcgttaaaggccttttatcgttaa

DBGET integrated database retrieval system