KEGG   Aeromonas salmonicida subsp. salmonicida A449: ASA_1825Help
Entry
ASA_1825          CDS       T00500                                 

Gene name
recR
Definition
(GenBank) recombination protein RecR
  KO
K06187  recombination protein RecR
Organism
asa  Aeromonas salmonicida subsp. salmonicida A449
Pathway
asa03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:asa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    ASA_1825 (recR)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:asa03400]
    ASA_1825 (recR)
DNA repair and recombination proteins [BR:asa03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     ASA_1825 (recR)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      ASA_1825 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Toprim_4 RecR Toprim HHH_5 HHH
Motif
Other DBs
NCBI-ProteinID: ABO89901
UniProt: A4SLX9
Position
1912234..1912836
Genome map
AA seq 200 aa AA seqDB search
MKFSPLLDEMMKALQVLPGVGPKSAQRMAFTLLERERSGGLRLAQLLNRALTEIGHCSHC
RTFTENALCEICANPKREESGLLCVVESPADVAAIEHTGQFSGRYFVLMGHLSPLDGIGP
EELGLEILEQRLKAESISELILATNPTIEGDATAWYIADMARAAGVKVSRIAHGVPVGGE
LELVDGTTLSHSLMGRQPLN
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgaaattcagccccctgctggatgagatgatgaaggccctgcaggtgctgccgggtgtc
ggccccaagtcggcccagcgcatggcctttaccctgctcgagcgcgagcgcagcggcggc
ttgcgtctggcccagctgctcaatcgggcgctgaccgagataggccactgcagccactgc
cgcaccttcaccgagaatgcgctttgcgagatctgcgccaatcccaagcgcgaagagagc
ggcttgctgtgtgtggtggagagcccggcggatgtggctgccatcgagcacacaggccag
ttctccggccgttacttcgtgctgatggggcacctgtcccccctcgatggcatcggccct
gaggagctggggctggagatcctggagcagcgtctgaaagcagagtccatcagcgagctg
atcctggccaccaaccccaccatcgaaggggatgccaccgcctggtatatcgccgacatg
gcccgcgccgctggcgtcaaggtgagccggattgcccacggcgtgccggtgggcggcgag
ttggagctggtggatggcaccacgctttctcactccttgatggggcgtcagccccttaat
tga

DBGET integrated database retrieval system