KEGG   Aeromonas salmonicida subsp. salmonicida A449: ASA_1829Help
Entry
ASA_1829          CDS       T00500                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K07136  uncharacterized protein
Organism
asa  Aeromonas salmonicida subsp. salmonicida A449
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MAPEG TMEM190
Motif
Other DBs
NCBI-ProteinID: ABO89905
UniProt: A4SLY3
Position
1917019..1917414
Genome map
AA seq 131 aa AA seqDB search
MMMHITLIYAGLLGLLFLLLSFWVVKRRAQFKVMIGEGEAPEMRSAIRAHGNFAEYVPLT
LLLMALCELAGVGALWLHVGGLCLLVGRILHAIGIQIPKAPNMPRLFGTLLFWLALGLFS
VLALVQGLSFG
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgatgatgcatatcacgttgatttacgcaggcctgctggggctgctgtttctgttgctc
tccttctgggtggtcaagcgccgtgcccagttcaaggtgatgataggggaaggggaggcg
cccgagatgcgctccgcgatccgtgctcatggcaacttcgccgagtatgtgccactgacc
ctgctgctgatggccctgtgtgagctggctggggtgggggcgctctggctccacgtcggc
ggtctttgcctcctggtggggcgtatcctgcacgccatcggtatccagatccccaaggcc
cccaacatgccgcggctgtttggtaccctgttgttctggttggcactggggctgttttct
gtgctggcactggtacaggggctctcgttcggctga

DBGET integrated database retrieval system