KEGG   Aeromonas salmonicida subsp. salmonicida A449: ASA_1831Help
Entry
ASA_1831          CDS       T00500                                 

Definition
(GenBank) methyl-accepting chemotaxis protein
  KO
K03406  methyl-accepting chemotaxis protein
Organism
asa  Aeromonas salmonicida subsp. salmonicida A449
Pathway
asa02020  Two-component system
asa02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:asa00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    ASA_1831
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    ASA_1831
Bacterial motility proteins [BR:asa02035]
 Flagellar system
  Chemotaxis proteins
   MCPs
    ASA_1831
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: sCache_2 MCPsignal dCache_2 Cache_3-Cache_2 HAMP DUF1804 Fib_alpha Med15_fungi
Motif
Other DBs
NCBI-ProteinID: ABO89907
UniProt: A4SLY5
Position
1919064..1920695
Genome map
AA seq 543 aa AA seqDB search
MLRQWSIGHRLLLVALMVLVIVAALLVTCLRVYHQGLMAEKSNQTRAQVETAYSLVAGFE
ARARQGELDDASARTQALAALRGLRYGQDDYFWVNDSHPTMVMHPMKPELDGKDLSGVED
KQGLKLFVAFVERVKQQAAGGEVAYYWPKPGVDEPVRKISYVKHFAPWDWIIGTGVYVDD
VDAQYQEVLRTLLGIGAVLALLLLGAVTLIGRSIVTPLAQSVSALGNIAKGEGDLRFRLP
ESGRDEVSLLSANFNLFANQMAQLVARTQQIAYQNREAAHQLEQVVVRTSAIVTDQEQDT
QRVADAMAQMTISSRAVGVNAEQAATAADTAQHLAQHGRQVVAQTIATIGQLADEMEETV
QAVARLEQDTKQIGSVLDVIRGIAEQTNLLALNAAIEAARAGEQGRGFAVVADEVRTLAT
RTHNSTDEIRQMIQRLQEGAGKVATGIGQLQQLSRSTAEKAGDAEGAIGDIDEAVGTIMT
MNNQIAEAASEQSRSTDEITQRLSAITQLANKALAENQRTGQAAGTLAHSSDELSALVGR
YRT
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atgttgaggcaatggagtattggccaccggttattgctggtggcgttgatggtgctggtc
atagtggctgcgctcctcgttacctgcctgcgggtttatcatcagggattgatggcggag
aagagcaatcagacccgcgcccaggtggagaccgcctacagtctggttgccggtttcgag
gcgagggcaagacagggtgagctggacgacgctagtgccaggacccaggccctggcggcc
ctgcggggattgcggtacggccaggacgactatttctgggtcaatgacagtcaccccacc
atggtgatgcatcccatgaaacccgaactcgatggcaaggatctctccggggtggaagac
aagcagggactcaagctattcgttgcctttgtcgagcgggtcaagcagcaggctgctggt
ggtgaggtggcttactactggcccaaacccggcgttgacgagccggttcgcaagatctcc
tacgtcaagcactttgccccctgggactggatcataggtaccggtgtctatgtggatgat
gtcgatgcccagtatcaggaagtgctgcgcaccctgctggggatcggtgccgtcttggcc
ttgctgttgctgggcgccgtgaccctgattgggcgcagcatagtgacaccgctggctcag
tccgtctcggccctgggcaatattgcaaagggtgagggggatctgcgttttcgtctgcca
gagagcggacgagatgaggtgagtctgctgtcggccaatttcaacctctttgccaaccag
atggctcagttggtggctcgcacccagcagatcgcctatcagaaccgggaggcggctcat
caactggagcaggttgtggtgcgaaccagcgccatcgtcacggatcaggaacaggatacc
cagcgggtcgccgacgccatggcccagatgaccatcagcagtcgcgccgtcggcgtgaat
gccgagcaggccgcaacggcagccgatacggcgcagcacctggctcagcatggccgccag
gtcgtagcgcagaccattgccaccatagggcaactggccgatgagatggaggagactgtg
caggcggtggcacgcctcgagcaggacaccaagcagataggctcagtgcttgacgtgata
agggggatcgccgagcagaccaacctgctggcgctcaatgcggccattgaagcggcgcgc
gccggtgaacaggggcgtggatttgcggtggtggccgatgaggtgcgtacactggcgacc
cgcacccataactcgaccgacgagatccggcagatgatccagcggttgcaagagggggct
ggcaaggtggcgaccgggattgggcagttgcaacaactctcgcgttcgacggcagagaag
gccggggatgccgagggcgccatcggtgacatcgatgaggcggtcggcaccatcatgacc
atgaacaatcagatagccgaggccgccagcgagcagagtcgatcgacggacgagatcacg
cagcgcctctccgccatcacccagcttgccaacaaggcacttgctgaaaatcagcgcaca
gggcaggcggcaggtaccttggctcactccagcgatgagctgagtgccctggtggggcga
tatcgcacttaa

DBGET integrated database retrieval system